UniProt ID | RH20_ARATH | |
---|---|---|
UniProt AC | Q9C718 | |
Protein Name | DEAD-box ATP-dependent RNA helicase 20 | |
Gene Name | RH20 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 501 | |
Subcellular Localization | Nucleus. | |
Protein Description | ATP-dependent RNA helicase involved nonsense-mediated mRNA decay and ribosome biogenesis through rRNA processing.. | |
Protein Sequence | MSRYDSRTGDSTSYRDRRSDSGFGGTSSYGSSGSHTSSKKDNDGNESPRKLDLDGLTPFEKNFYVESPAVAAMTDTEVEEYRKLREITVEGKDIPKPVKSFRDVGFPDYVLEEVKKAGFTEPTPIQSQGWPMAMKGRDLIGIAETGSGKTLSYLLPAIVHVNAQPMLAHGDGPIVLVLAPTRELAVQIQQEASKFGSSSKIKTTCIYGGVPKGPQVRDLQKGVEIVIATPGRLIDMMESNNTNLRRVTYLVLDEADRMLDMGFDPQIRKIVSHIRPDRQTLYWSATWPKEVEQLSKKFLYNPYKVIIGSSDLKANRAIRQIVDVISESQKYNKLVKLLEDIMDGSRILVFLDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFRSGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTVANARFAKELTNILQEAGQKVSPELASMGRSTAPPPPGLGGFRDRGSRRGWS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
21 | Phosphorylation | YRDRRSDSGFGGTSS CCCCCCCCCCCCCCC | 36.95 | 30407730 | |
26 | Phosphorylation | SDSGFGGTSSYGSSG CCCCCCCCCCCCCCC | 18.19 | 30407730 | |
27 | Phosphorylation | DSGFGGTSSYGSSGS CCCCCCCCCCCCCCC | 25.49 | 30407730 | |
28 | Phosphorylation | SGFGGTSSYGSSGSH CCCCCCCCCCCCCCC | 33.09 | 30407730 | |
29 | Phosphorylation | GFGGTSSYGSSGSHT CCCCCCCCCCCCCCC | 22.31 | 30407730 | |
31 | Phosphorylation | GGTSSYGSSGSHTSS CCCCCCCCCCCCCCC | 24.24 | 30407730 | |
32 | Phosphorylation | GTSSYGSSGSHTSSK CCCCCCCCCCCCCCC | 39.70 | 30407730 | |
47 | Phosphorylation | KDNDGNESPRKLDLD CCCCCCCCCCEECCC | 33.72 | 23776212 | |
57 | Phosphorylation | KLDLDGLTPFEKNFY EECCCCCCCCCCCEE | 31.31 | 23776212 | |
204 | Phosphorylation | SSSKIKTTCIYGGVP CCCCCEEEEEECCCC | 7.60 | 19880383 | |
342 | Sulfoxidation | VKLLEDIMDGSRILV HHHHHHHHCCCCEEE | 8.05 | 23289948 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RH20_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RH20_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RH20_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RH20_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...