RH20_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RH20_ARATH
• UniProt AC: Q9C718
• Protein Name: DEAD-box ATP-dependent RNA helicase 20
• Gene Name: RH20
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 501
• Subcellular Localization: Nucleus.
• Protein Description: ATP-dependent RNA helicase involved nonsense-mediated mRNA decay and ribosome biogenesis through rRNA processing..
• Protein Sequence: MSRYDSRTGDSTSYRDRRSDSGFGGTSSYGSSGSHTSSKKDNDGNESPRKLDLDGLTPFEKNFYVESPAVAAMTDTEVEEYRKLREITVEGKDIPKPVKSFRDVGFPDYVLEEVKKAGFTEPTPIQSQGWPMAMKGRDLIGIAETGSGKTLSYLLPAIVHVNAQPMLAHGDGPIVLVLAPTRELAVQIQQEASKFGSSSKIKTTCIYGGVPKGPQVRDLQKGVEIVIATPGRLIDMMESNNTNLRRVTYLVLDEADRMLDMGFDPQIRKIVSHIRPDRQTLYWSATWPKEVEQLSKKFLYNPYKVIIGSSDLKANRAIRQIVDVISESQKYNKLVKLLEDIMDGSRILVFLDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFRSGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTVANARFAKELTNILQEAGQKVSPELASMGRSTAPPPPGLGGFRDRGSRRGWS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
21	Phosphorylation	YRDRRSDSGFGGTSS CCCCCCCCCCCCCCC	36.95	30407730
26	Phosphorylation	SDSGFGGTSSYGSSG CCCCCCCCCCCCCCC	18.19	30407730
27	Phosphorylation	DSGFGGTSSYGSSGS CCCCCCCCCCCCCCC	25.49	30407730
28	Phosphorylation	SGFGGTSSYGSSGSH CCCCCCCCCCCCCCC	33.09	30407730
29	Phosphorylation	GFGGTSSYGSSGSHT CCCCCCCCCCCCCCC	22.31	30407730
31	Phosphorylation	GGTSSYGSSGSHTSS CCCCCCCCCCCCCCC	24.24	30407730
32	Phosphorylation	GTSSYGSSGSHTSSK CCCCCCCCCCCCCCC	39.70	30407730
47	Phosphorylation	KDNDGNESPRKLDLD CCCCCCCCCCEECCC	33.72	23776212
57	Phosphorylation	KLDLDGLTPFEKNFY EECCCCCCCCCCCEE	31.31	23776212
204	Phosphorylation	SSSKIKTTCIYGGVP CCCCCEEEEEECCCC	7.60	19880383
342	Sulfoxidation	VKLLEDIMDGSRILV HHHHHHHHCCCCEEE	8.05	23289948

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RH20_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RH20_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RH20_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of RH20_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.