UniProt ID | 1A16_ARATH | |
---|---|---|
UniProt AC | Q9SAR0 | |
Protein Name | 1-aminocyclopropane-1-carboxylate synthase 6 | |
Gene Name | ACS6 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 495 | |
Subcellular Localization | ||
Protein Description | 1-aminocyclopropane-1-carboxylate synthase (ACS) enzymes catalyze the conversion of S-adenosyl-L-methionine (SAM) into 1-aminocyclopropane-1-carboxylate (ACC), a direct precursor of ethylene. Involved in bacterial flagellin-induced ethylene production.. | |
Protein Sequence | MVAFATEKKQDLNLLSKIASGDGHGENSSYFDGWKAYEENPFHPIDRPDGVIQMGLAENQLCGDLMRKWVLKHPEASICTSEGVNQFSDIAIFQDYHGLPEFRQAVAKFMEKTRNNKVKFDPDRIVMSGGATGAHETVAFCLANPGDGFLVPTPYYPGFDRDLRWRTGVNLVPVTCHSSNGFKITVEALEAAYENARKSNIPVKGLLVTNPSNPLGTTLDRECLKSLVNFTNDKGIHLIADEIYAATTFGQSEFISVAEVIEEIEDCNRDLIHIVYSLSKDMGLPGLRVGIVYSYNDRVVQIARKMSSFGLVSSQTQHLIAKMLSDEEFVDEFIRESKLRLAARHAEITTGLDGLGIGWLKAKAGLFLWMDLRNLLKTATFDSETELWRVIVHQVKLNVSPGGSFHCHEPGWFRVCFANMDHKTMETALERIRVFTSQLEEETKPMAATTMMAKKKKKCWQSNLRLSFSDTRRFDDGFFSPHSPVPPSPLVRAQT | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
280 | N6-(pyridoxal phosphate)lysine | HIVYSLSKDMGLPGL HHHHHHHHHCCCCCE | 57.96 | - | |
280 | Other | HIVYSLSKDMGLPGL HHHHHHHHHCCCCCE | 57.96 | - | |
480 | Phosphorylation | RFDDGFFSPHSPVPP CCCCCCCCCCCCCCC | 21.31 | 15539472 | |
483 | Phosphorylation | DGFFSPHSPVPPSPL CCCCCCCCCCCCCHH | 30.86 | 15539472 | |
488 | Phosphorylation | PHSPVPPSPLVRAQT CCCCCCCCHHCCCCC | 25.46 | 15539472 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of 1A16_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of 1A16_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of 1A16_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
P2C56_ARATH | ABI1 | physical | 24637173 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Phosphorylation of 1-aminocyclopropane-1-carboxylic acid synthase byMPK6, a stress-responsive mitogen-activated protein kinase, inducesethylene biosynthesis in Arabidopsis."; Liu Y., Zhang S.; Plant Cell 16:3386-3399(2004). Cited for: FUNCTION, PHOSPHORYLATION AT SER-480; SER-483 AND SER-488, ANDMUTAGENESIS OF SER-480; SER-483 AND SER-488. |