dbPTM

ERDL8_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	ERDL8_ARATH
UniProt AC	Q0WQ63
Protein Name	Sugar transporter ERD6-like 8
Gene Name	At3g05150
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	470
Subcellular Localization	Membrane Multi-pass membrane protein.
Protein Description	Sugar transporter..
Protein Sequence	METRKDDMEKRNDKSEPLLLPENGSDVSEEASWMVYLSTIIAVCGSYEFGTCVGYSAPTQFGIMEELNLSYSQFSVFGSILNMGAVLGAITSGKISDFIGRKGAMRLSSVISAIGWLIIYLAKGDVPLDFGRFLTGYGCGTLSFVVPVFIAEISPRKLRGALATLNQLFIVIGLASMFLIGAVVNWRTLALTGVAPCVVLFFGTWFIPESPRWLEMVGRHSDFEIALQKLRGPQANITREAGEIQEYLASLAHLPKATLMDLIDKKNIRFVIVGVGLMFFQQFVGINGVIFYAQQIFVSAGASPTLGSILYSIEQVVLTALGATLLIDRLGRRPLLMASAVGMLIGCLLIGNSFLLKAHGLALDIIPALAVSGVLVYIGSFSIGMGAIPWVIMSEIFPINLKGTAGGLVTVVNWLSSWLVSFTFNFLMIWSPHGTFYVYGGVCVLAIIFIAKLVPETKGRTLEEIQAMMM

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
461	Phosphorylation	VPETKGRTLEEIQAM CCCCCCCCHHHHHHH	47.38	24894044

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of ERDL8_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of ERDL8_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of ERDL8_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
HHP2_ARATH	HHP2	physical	24833385
HHP4_ARATH	HHP4	physical	24833385
UBC32_ARATH	UBC32	physical	24833385
UBC34_ARATH	UBC34	physical	24833385
CNIH1_ARATH	AT3G12180	physical	24833385
MSBP2_ARATH	MAPR3	physical	24833385
CP21D_ARATH	AT3G66654	physical	24833385
Y5815_ARATH	AT5G58150	physical	24833385
BET12_ARATH	ATBET12	physical	24833385
VAP21_ARATH	AT5G47180	physical	24833385
MMGT_ARATH	AT5G03345	physical	24833385

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of ERDL8_ARATH

Related Literatures of Post-Translational Modification