BET12_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: BET12_ARATH
• UniProt AC: Q94CG2
• Protein Name: Bet1-like SNARE 1-2
• Gene Name: BET12
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 130
• Subcellular Localization: Golgi apparatus membrane; Single-pass type IV membrane protein. Endoplasmic reticulum membrane; Single-pass type IV membrane protein.
• Protein Description: Required for vesicular transport from the ER to the Golgi complex. Functions as a SNARE associated with ER-derived vesicles (By similarity)..
• Protein Sequence: MNFRRENRASRTSLFDGLDGLEEGRLRASSSYAHDERDNDEALENLQDRVSFLKRVTGDIHEEVENHNRLLDKVGNKMDSARGIMSGTINRFKLVFEKKSNRKSCKLIAYFVLLFLIMYYLIRLLNYIKG

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
10	Phosphorylation	FRRENRASRTSLFDG CCCCCCCCCCCCCCC	32.62	25561503
12	Phosphorylation	RENRASRTSLFDGLD CCCCCCCCCCCCCCC	27.56	25561503
13	Phosphorylation	ENRASRTSLFDGLDG CCCCCCCCCCCCCCC	26.40	25561503
51	Phosphorylation	ENLQDRVSFLKRVTG HHHHHHHHHHHHHHC	26.25	30407730

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of BET12_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of BET12_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of BET12_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
NAC89_ARATH	NAC089	physical	21798944
NIP11_ARATH	NLM1	physical	21798944

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.