UBC34_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: UBC34_ARATH
• UniProt AC: Q9SHI7
• Protein Name: Ubiquitin-conjugating enzyme E2 34
• Gene Name: UBC34
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 237
• Subcellular Localization: Membrane ; Single-pass membrane protein .
• Protein Description: Accepts the ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins..
• Protein Sequence: MAEKACIKRLQKEYRALCKEPVSHVVARPSPNDILEWHYVLEGSEGTPFAGGFYYGKIKFPPEYPYKPPGITMTTPNGRFMTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDTSPTTGSVNTTVIEKQRLAKSSLAFNCKTPAFRKLFPEYVEKYNQQQLAEQATTQLTTPESPQKSDTKVESEKTIDPTKGDSEGGLKERKKNNKQGLPAWIILLLVSVFGVVMALPLLQL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
178	Phosphorylation	TQLTTPESPQKSDTK HHCCCCCCCCCCCCC	33.56	30291188
204	Acetylation	GDSEGGLKERKKNNK CCCCCCHHHHHHHCC	59.76	21311030

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of UBC34_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of UBC34_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of UBC34_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
NIP11_ARATH	NLM1	physical	21798944

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.