dbPTM

NIP12_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	NIP12_ARATH
UniProt AC	Q8LFP7
Protein Name	Aquaporin NIP1-2
Gene Name	NIP1-2
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	294
Subcellular Localization	Membrane Multi-pass membrane protein .
Protein Description	Water channel probably required to promote glycerol permeability and water transport across cell membranes..
Protein Sequence	MAEISGNGGDARDGAVVVNLKEEDEQQQQQQAIHKPLKKQDSLLSISVPFLQKLMAEVLGTYFLIFAGCAAVAVNTQHDKAVTLPGIAIVWGLTVMVLVYSLGHISGAHFNPAVTIAFASCGRFPLKQVPAYVISQVIGSTLAAATLRLLFGLDQDVCSGKHDVFVGTLPSGSNLQSFVIEFIITFYLMFVISGVATDNRAIGELAGLAVGSTVLLNVIIAGPVSGASMNPGRSLGPAMVYSCYRGLWIYIVSPIVGAVSGAWVYNMVRYTDKPLREITKSGSFLKTVRNGSSR

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MAEISGNG -------CCCCCCCC	7.33	-
159	Phosphorylation	GLDQDVCSGKHDVFV CCCCHHHCCCCCEEE	51.21	25368622
283	Phosphorylation	REITKSGSFLKTVRN HHHHCCCCCHHHCCC	34.20	17586839

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of NIP12_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of NIP12_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of NIP12_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of NIP12_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of NIP12_ARATH

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Temporal analysis of sucrose-induced phosphorylation changes inplasma membrane proteins of Arabidopsis."; Niittylae T., Fuglsang A.T., Palmgren M.G., Frommer W.B.,Schulze W.X.; Mol. Cell. Proteomics 6:1711-1726(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-283, AND MASSSPECTROMETRY.	17586839 [Abstract]