UniProt ID | NIP12_ARATH | |
---|---|---|
UniProt AC | Q8LFP7 | |
Protein Name | Aquaporin NIP1-2 | |
Gene Name | NIP1-2 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 294 | |
Subcellular Localization |
Membrane Multi-pass membrane protein . |
|
Protein Description | Water channel probably required to promote glycerol permeability and water transport across cell membranes.. | |
Protein Sequence | MAEISGNGGDARDGAVVVNLKEEDEQQQQQQAIHKPLKKQDSLLSISVPFLQKLMAEVLGTYFLIFAGCAAVAVNTQHDKAVTLPGIAIVWGLTVMVLVYSLGHISGAHFNPAVTIAFASCGRFPLKQVPAYVISQVIGSTLAAATLRLLFGLDQDVCSGKHDVFVGTLPSGSNLQSFVIEFIITFYLMFVISGVATDNRAIGELAGLAVGSTVLLNVIIAGPVSGASMNPGRSLGPAMVYSCYRGLWIYIVSPIVGAVSGAWVYNMVRYTDKPLREITKSGSFLKTVRNGSSR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MAEISGNG -------CCCCCCCC | 7.33 | - | |
159 | Phosphorylation | GLDQDVCSGKHDVFV CCCCHHHCCCCCEEE | 51.21 | 25368622 | |
283 | Phosphorylation | REITKSGSFLKTVRN HHHHCCCCCHHHCCC | 34.20 | 17586839 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NIP12_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NIP12_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NIP12_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of NIP12_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Temporal analysis of sucrose-induced phosphorylation changes inplasma membrane proteins of Arabidopsis."; Niittylae T., Fuglsang A.T., Palmgren M.G., Frommer W.B.,Schulze W.X.; Mol. Cell. Proteomics 6:1711-1726(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-283, AND MASSSPECTROMETRY. |