THIK2_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: THIK2_ARATH
• UniProt AC: Q56WD9
• Protein Name: 3-ketoacyl-CoA thiolase 2, peroxisomal
• Gene Name: PED1
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 462
• Subcellular Localization: Peroxisome. Glyoxysome. Peroxisomal targeting signal type 2 (PTS2-type) import is temperature and ATP-dependent, induced by zinc ions and PTS1-type import, but repressed by mature forms of PED1.
• Protein Description: Involved in long chain fatty-acid beta-oxidation prior to gluconeogenesis during germination and subsequent seedling growth. Confers sensitivity to 2,4-dichlorophenoxybutiric acid (2,4-DB). Required for local and systemic induction of jasmonic acid (JA) biosynthesis after wounding. Seems to be involved in JA biosynthesis during senescence..
• Protein Sequence: MEKAIERQRVLLEHLRPSSSSSHNYEASLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTPLCKSKRGNFKDTYPDDLLAPVLRALIEKTNLNPSEVGDIVVGTVLAPGSQRASECRMAAFYAGFPETVAVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPMAWEGSVNPAVKKFAQAQNCLLPMGVTSENVAQRFGVSRQEQDQAAVDSHRKAAAATAAGKFKDEIIPVKTKLVDPKTGDEKPITVSVDDGIRPTTTLASLGKLKPVFKKDGTTTAGNSSQVSDGAGAVLLMKRSVAMQKGLPVLGVFRTFAAVGVDPAIMGIGPAVAIPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDGVDELRNARKVEAQGLLSKDAR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
110	Phosphorylation	GTVLAPGSQRASECR EEEECCCCHHHHHHH	18.55	30291188
304	Sulfoxidation	GAGAVLLMKRSVAMQ CCCCEEEEHHHHHHH	2.72	23289948
310	Sulfoxidation	LMKRSVAMQKGLPVL EEHHHHHHHCCCCCC	3.86	25693801

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of THIK2_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of THIK2_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of THIK2_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SKL2_ARATH	SKL2	physical	21798944

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.