UniProt ID | FLA8_ARATH | |
---|---|---|
UniProt AC | O22126 | |
Protein Name | Fasciclin-like arabinogalactan protein 8 | |
Gene Name | FLA8 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 420 | |
Subcellular Localization |
Cell membrane Lipid-anchor, GPI-anchor. |
|
Protein Description | May be a cell surface adhesion protein.. | |
Protein Sequence | MAASQTFSLLAFTFSLLAFASTVSSHNITQILADSPDYSSFNSYLSQTKLADEINSRTTITVLVLNNGAMSALAGKHPLSVIKSALSLLVLLDYYDPQKLHKISKGTTLSTTLYQTTGNAPGNLGFVNITDLKGGKVGFGSAASGSKLDSSYTKSVKQIPYNISILEIDAPIIAPGVLTAPAPSASLSNITGLLEKAGCKTFANLLVSSGVLKTYESAVEKGLTVFAPSDEAFKAEGVPDLTKLTQAEVVSLLEYHALAEYKPKGSLKTNKNNISTLATNGAGKFDLTTSTSGDEVILHTGVAPSRLADTVLDATPVVIFTVDNVLLPAELFGKSKSPSPAPAPEPVTAPTPSPADAPSPTAASPPAPPTDESPESAPSDSPTGSANSKSANAAVGVSTPSLFTALVTIAAIAVSVSLCS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
27 | N-linked_Glycosylation | ASTVSSHNITQILAD HHHHHCCCHHHHHCC | 40.73 | - | |
128 | N-linked_Glycosylation | PGNLGFVNITDLKGG CCCEEEEEEEECCCC | 29.22 | - | |
141 | Phosphorylation | GGKVGFGSAASGSKL CCEEECCCCCCCCCC | 20.57 | 28295753 | |
146 | Phosphorylation | FGSAASGSKLDSSYT CCCCCCCCCCCCCCC | 27.79 | 28295753 | |
162 | N-linked_Glycosylation | SVKQIPYNISILEID CCCCCCCCEEEEEEC | 19.04 | - | |
189 | N-linked_Glycosylation | APSASLSNITGLLEK CCCCCHHHHHHHHHH | 40.93 | - | |
273 | N-linked_Glycosylation | SLKTNKNNISTLATN CCCCCCCCHHHHCCC | 31.06 | - | |
392 | GPI-anchor | SANSKSANAAVGVST CCCCCHHCHHCCCCC | 35.21 | 12805588 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FLA8_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FLA8_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FLA8_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of FLA8_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...