RAN2_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RAN2_ARATH
• UniProt AC: P41917
• Protein Name: GTP-binding nuclear protein Ran-2
• Gene Name: RAN2
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 221
• Subcellular Localization: Nucleus . Nucleus envelope . Localized in the perinuclear region with the highest concentration at the nuclear envelope at the interphase.
• Protein Description: GTP-binding protein involved in nucleocytoplasmic transport. Required for the import of protein into the nucleus and also for RNA export. Involved in chromatin condensation and control of cell cycle (By similarity)..
• Protein Sequence: MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDQNLHFVESPALAPPEVHLDIAAQQQNEADLAAAAAQPLPDDDDDAFE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
8	Phosphorylation	MALPNQQTVDYPSFK CCCCCCCCCCCCCCE	12.94	23328941

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RAN2_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RAN2_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RAN2_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RBP1B_ARATH	AT2G30060	physical	9025305
RBP1A_ARATH	SIRANBP	physical	9025305

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.