dbPTM

RBP1A_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RBP1A_ARATH
UniProt AC	Q9LMK7
Protein Name	Ran-binding protein 1 homolog a
Gene Name	RANBP1A
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	228
Subcellular Localization	Nucleus, nuclear pore complex.
Protein Description
Protein Sequence	MATNEPEHEHRDEEEAGANEDEDTGAQVAPIVRLEEVAVTTGEEDEDAVLDLKSKLYRFDKDANQWKERGAGTVKFLKHKNTGKIRLVMRQSKTLKICANHFVKSGMSVQEHVGNEKSCVWHARDFADGELKDELFCIRFASIENCKTFMQKFKEVAESEEEKEESKDAADTAGLLEKLTVEETKTEEKTEAKAVETAKTEVKAEEKKESEAEKSGEAKKTEESGPST

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
107	Sulfoxidation	NHFVKSGMSVQEHVG HHHHHCCCCHHHHCC	4.59	25693801
159	Phosphorylation	KFKEVAESEEEKEES HHHHHHHCHHHHHHH	40.34	30291188
166	Phosphorylation	SEEEKEESKDAADTA CHHHHHHHHHHHHHH	36.61	30407730
215	Phosphorylation	KESEAEKSGEAKKTE HHHHHHHHCCCCCCC	33.11	25561503
221	Phosphorylation	KSGEAKKTEESGPST HHCCCCCCCCCCCCC	44.25	23111157
224	Phosphorylation	EAKKTEESGPST--- CCCCCCCCCCCC---	50.17	25561503
227	Phosphorylation	KTEESGPST------ CCCCCCCCC------	50.72	23111157
228	Phosphorylation	TEESGPST------- CCCCCCCC-------	45.85	25561503

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RBP1A_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RBP1A_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RBP1A_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
RAN1_ARATH	RAN-1	physical	9025305
RAN3_ARATH	RAN3	physical	21798944

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RBP1A_ARATH

Related Literatures of Post-Translational Modification