STR16_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: STR16_ARATH
• UniProt AC: Q39129
• Protein Name: Thiosulfate sulfurtransferase 16, chloroplastic
• Gene Name: STR16
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 120
• Subcellular Localization: Plastid, chloroplast .
• Protein Description: Thought to act during the early stages of leaf senescence. Catalyzes the transfer of a sulfur ion from a donor to cyanide or to other thiol compounds. Substrate preference is thiosulfate > 3-mercaptopyruvate..
• Protein Sequence: MAEESRVPSSVSVTVAHDLLLAGHRYLDVRTPEEFSQGHACGAINVPYMNRGASGMSKNPDFLEQVSSHFGQSDNIIVGCQSGGRSIKATTDLLHAGFTGVKDIVGGYSAWAKNGLPTKA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
10	Phosphorylation	EESRVPSSVSVTVAH CCCCCCCCEEEEHHH	16.61	28011693
12	Phosphorylation	SRVPSSVSVTVAHDL CCCCCCEEEEHHHHH	17.64	28011693
109	Phosphorylation	KDIVGGYSAWAKNGL HHHHCCHHHHHHCCC	22.17	30291188

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of STR16_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of STR16_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of STR16_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of STR16_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.