dbPTM

ATL1_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	ATL1_ARATH
UniProt AC	P93823
Protein Name	RING-H2 finger protein ATL1
Gene Name	ATL1
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	381
Subcellular Localization	Membrane Single-pass membrane protein .
Protein Description
Protein Sequence	MDLTDRRNPFNNLVFPPPPPPPSTTFTSPIFPRTSSSGTNFPILAIAVIGILATAFLLVSYYIFVIKCCLNWHQIDIFRRRRRSSDQNPLMIYSPHEVNRGLDESAIRAIPVFKFKKRDVVAGEEDQSKNSQECSVCLNEFQEDEKLRIIPNCCHVFHIDCIDIWLQGNANCPLCRTSVSCEASFTLDLISAPSSPRENSPHSRNRNLEPGLVLGGDDDFVVIELGASNGNNRESVRNIDFLTEQERVTSNEVSTGNSPKSVSPLPIKFGNRGMYKKERKFHKVTSMGDECIDTRGKDGHFGEIQPIRRSISMDSSVDRQLYLAVQEEISRRNRQIPVAGDGEDSSSSGGGNSRVMKRCFFSFGSSRTSKSSSILPVYLEP

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
184	Phosphorylation	TSVSCEASFTLDLIS CCCCEEEEEEEEEEC	9.11	22074104
310	Phosphorylation	EIQPIRRSISMDSSV CCCCCCCEECCCCCH	14.79	30407730
312	Phosphorylation	QPIRRSISMDSSVDR CCCCCEECCCCCHHH	20.13	30407730
315	Phosphorylation	RRSISMDSSVDRQLY CCEECCCCCHHHHHH	24.50	30407730
316	Phosphorylation	RSISMDSSVDRQLYL CEECCCCCHHHHHHH	24.63	30407730

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of ATL1_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of ATL1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of ATL1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
UB2D1_HUMAN	UBE2D1	physical	25398498
ATL1_ARATH	AT1G04360	physical	25398498
UBQ3_ARATH	UBQ3	physical	25398498
WNK3_ARATH	WNK3	physical	24833385
CRK40_ARATH	CRK40	physical	24833385

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of ATL1_ARATH

Related Literatures of Post-Translational Modification