PER17_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PER17_ARATH
• UniProt AC: Q9SJZ2
• Protein Name: Peroxidase 17
• Gene Name: PER17
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 329
• Subcellular Localization: Secreted . Vacuole . Carboxy-terminal extension appears to target the protein to vacuoles.
• Protein Description: Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress. These functions might be dependent on each isozyme/isoform in each plant tissue..
• Protein Sequence: MSLLPHLILYLTLLTVVVTGETLRPRFYSETCPEAESIVRREMKKAMIKEARSVASVMRFQFHDCFVNGCDASLLLDDTPNMLGEKLSLSNIDSLRSFEVVDDIKEALEKACPATVSCADIVIMAARDAVALTGGPDWEVKLGRKDSLTASQQDSDDIMPSPRANATFLIDLFERFNLSVKDMVALSGSHSIGQGRCFSIMFRLYNQSGSGKPDPALEPSYRKKLDKLCPLGGDENVTGDLDATPQVFDNQYFKDLVSGRGFLNSDQTLYTNLVTREYVKMFSEDQDEFFRAFAEGMVKLGDLQSGRPGEIRFNCRVVNRRPIDVLLVS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
88	Phosphorylation	NMLGEKLSLSNIDSL CCCCCCCCCCCHHHC	40.60	27288362
90	Phosphorylation	LGEKLSLSNIDSLRS CCCCCCCCCHHHCCC	28.50	27288362
94	Phosphorylation	LSLSNIDSLRSFEVV CCCCCHHHCCCCEEC	23.14	27288362
159	Sulfoxidation	QQDSDDIMPSPRANA HCCCCCCCCCHHHCC	3.28	23289948
165	N-linked_Glycosylation	IMPSPRANATFLIDL CCCCHHHCCEEHHHH	40.57	-
177	N-linked_Glycosylation	IDLFERFNLSVKDMV HHHHHHCCCCHHHHH	37.31	-
206	N-linked_Glycosylation	SIMFRLYNQSGSGKP HHHEEHHHCCCCCCC	33.85	-
236	N-linked_Glycosylation	CPLGGDENVTGDLDA CCCCCCCCCCCCCCC	41.20	-
281	Sulfoxidation	VTREYVKMFSEDQDE CCHHHHHHHCCCHHH	2.97	23289948

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PER17_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PER17_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PER17_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of PER17_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.