dbPTM

ATX3H_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	ATX3H_ARATH
UniProt AC	Q9M391
Protein Name	Ataxin-3 homolog
Gene Name	At3g54130
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	280
Subcellular Localization	Nucleus.
Protein Description	Interacts with key regulators of transcription and represses transcription. Acts as a histone-binding protein that regulates transcription. Acts as a deubiquitinating enzyme (By similarity)..
Protein Sequence	MERTSNGGMLYHEVQESNLCAVHCVNTVLQGPFFSEFDLAAVAADLDGKERQVMLEGAAVGGFAPGDFLAEESHNVSLGGDFSIQVLQKALEVWDLQVIPLNCPDAEPAQIDPELESAFICHLHDHWFCIRKVNGEWYNFDSLLAAPQHLSKFYLSAFLDSLKGAGWSIFIVKGNFPQECPMSSSSEASNSFGQWLSPEDAERIRKNTSSGSSARNKRSNDNVNQQRRNQALSREEVQAFSEMEDDDLKAAIAASLLDASAAEANLGAVGTSEKETEKQK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
233	Phosphorylation	QRRNQALSREEVQAF HHHHHHCCHHHHHHH	40.43	30407730
241	Phosphorylation	REEVQAFSEMEDDDL HHHHHHHHHCCHHHH	38.76	23111157

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of ATX3H_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of ATX3H_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of ATX3H_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of ATX3H_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of ATX3H_ARATH

Related Literatures of Post-Translational Modification