UniProt ID | ARFO_ARATH | |
---|---|---|
UniProt AC | Q9LQE3 | |
Protein Name | Putative auxin response factor 15 | |
Gene Name | ARF15 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 593 | |
Subcellular Localization | Nucleus. | |
Protein Description | Auxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression.. | |
Protein Sequence | METGNVVNAQPELSGIIDRSKSYMYEQLWKLCAGPLCDIPKLGEKVYYFPQGNIELVEASTREELNELQPICDLPSKLQCRVIAIHLKVENNSDETYAKITLMPDTTQVVIPTQNENQFRPLVNSFTKVLTASDISANGVFSVPKKHAIECLPPLDMSQPLPAQELLAIDLHGNQWSFRHSYRGTPQRHLLTTGWNEFTTSKKLVKGDVIVFVRGETGELRVGIRRARHQQGNIPSSIVSIDCMRHGVIASAKHAFDNQCMFIVVYKPRSSQFIVSYDKFLDAVNNKFNVGSRFTMRFEGDDLSERRYFGTIIGVSNFSPHWKCSDWRSLEVQWDEFASFLRPNKVSPWEIEHLMPALNVPRSSFLKNKRLREVNEFGSSSSHLLPPILTQGQEIGQLSVASPMNISLLYRETTEDAMNPSRLLMSYPVQPMPKRNYNNQMVTQIEENITTKAGTNFRLFGVSLATPPVIKDPIEQIGSDISKLTEGKKFGQSQTLRSPTKIQSKQFSSTRTCTKVQMQGVTIGRAVDLSVLNGYDQLILELEKLFDLKGQLQTRNQWKIIFTGSDEDEMLVGDDPWPEFCNMVKRIYIQKRR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ARFO_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ARFO_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ARFO_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of ARFO_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...