CP18C_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CP18C_ARATH
• UniProt AC: P34790
• Protein Name: Peptidyl-prolyl cis-trans isomerase CYP18-3
• Gene Name: CYP18-3
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 172
• Subcellular Localization: Cytoplasm .
• Protein Description: PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. Involved in de-etiolation. Reduces the sensitivity to brassinosteroids by decreasing somehow the abundance of the partially dephosphorylated form of BES1. Triggers the activation of bacterial AvrRpt2 protease activity upon infection by P.syringae. Activated AvrRpt2 confers virulence in plant lacking the RPS2 resistance gene. In plants expressing RPS2, the AvrRpt2-mediated degradation of RIN4 activates RPS2, which induces hypersensitive response (HR) and plant resistance..
• Protein Sequence: MAFPKVYFDMTIDGQPAGRIVMELYTDKTPRTAENFRALCTGEKGVGGTGKPLHFKGSKFHRVIPNFMCQGGDFTAGNGTGGESIYGSKFEDENFERKHTGPGILSMANAGANTNGSQFFICTVKTDWLDGKHVVFGQVVEGLDVVKAIEKVGSSSGKPTKPVVVADCGQLS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
10	Sulfoxidation	FPKVYFDMTIDGQPA CCEEEEEEEECCEEC	2.25	23289948
75	Phosphorylation	MCQGGDFTAGNGTGG EEECCCCCCCCCCCC	38.09	19880383
88	Phosphorylation	GGESIYGSKFEDENF CCCCCCCCCCCCCCC	19.73	19880383
154	Phosphorylation	KAIEKVGSSSGKPTK HHHHHHCCCCCCCCC	25.07	23776212
155	Phosphorylation	AIEKVGSSSGKPTKP HHHHHCCCCCCCCCC	36.86	23776212
156	Phosphorylation	IEKVGSSSGKPTKPV HHHHCCCCCCCCCCE	53.16	23776212
160	Phosphorylation	GSSSGKPTKPVVVAD CCCCCCCCCCEEEEE	52.01	23776212

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CP18C_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CP18C_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CP18C_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RIN4_ARATH	RIN4	physical	25299333

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.