UniProt ID | SUMO3_RAT | |
---|---|---|
UniProt AC | Q5XIF4 | |
Protein Name | Small ubiquitin-related modifier 3 {ECO:0000305} | |
Gene Name | Sumo3 | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 110 | |
Subcellular Localization | Cytoplasm. Nucleus. Nucleus, PML body. | |
Protein Description | Ubiquitin-like protein which can be covalently attached to target lysines either as a monomer or as a lysine-linked polymer. Does not seem to be involved in protein degradation and may function as an antagonist of ubiquitin in the degradation process. Plays a role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. Covalent attachment to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I, and can be promoted by an E3 ligase such as PIAS1-4, RANBP2 or CBX4. Plays a role in the regulation of sumoylation status of SETX (By similarity).. | |
Protein Sequence | MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGTASRASVPTPSHFPDICY | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
5 | Acetylation | ---MSEEKPKEGVKT ---CCCCCCCCCCCC | 58.29 | 22902405 | |
7 | Acetylation | -MSEEKPKEGVKTEN -CCCCCCCCCCCCCC | 77.49 | 22902405 | |
11 | Acetylation | EKPKEGVKTENDHIN CCCCCCCCCCCCCEE | 62.06 | 22902405 | |
27 | Phosphorylation | KVAGQDGSVVQFKIK EEECCCCCEEEEEEE | 27.66 | 23984901 | |
32 | Acetylation | DGSVVQFKIKRHTPL CCCEEEEEEEECCHH | 30.17 | 72586753 | |
41 | Acetylation | KRHTPLSKLMKAYCE EECCHHHHHHHHHHH | 61.35 | 22648881 | |
41 | Ubiquitination | KRHTPLSKLMKAYCE EECCHHHHHHHHHHH | 61.35 | - | |
44 | Acetylation | TPLSKLMKAYCERQG CHHHHHHHHHHHHCC | 46.79 | 14497041 | |
44 | Ubiquitination | TPLSKLMKAYCERQG CHHHHHHHHHHHHCC | 46.79 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SUMO3_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SUMO3_RAT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SUMO3_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...