| UniProt ID | ARF2_RAT | |
|---|---|---|
| UniProt AC | P84082 | |
| Protein Name | ADP-ribosylation factor 2 | |
| Gene Name | Arf2 | |
| Organism | Rattus norvegicus (Rat). | |
| Sequence Length | 181 | |
| Subcellular Localization | Golgi apparatus. | |
| Protein Description | GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. Involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus.. | |
| Protein Sequence | MGNVFEKLFKSLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELTRMLAEDELRDAVLLVFVNKQDLPNAMNAAEITDKLGLHSLRQRNWYIQATCATSGDGLYEGLDWLSNQLKNQK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Myristoylation | ------MGNVFEKLF ------CCHHHHHHH | 38.72 | - | |
| 36 | Acetylation | GKTTILYKLKLGEIV CCEEEEEEEECCCEE | 35.38 | 31097137 | |
| 73 | Ubiquitination | WDVGGQDKIRPLWRH EECCCCCCCHHHHHH | 32.50 | - | |
| 142 | Acetylation | NAAEITDKLGLHSLR CHHHHHHHHCCHHHH | 35.49 | 66708769 | |
| 142 | Ubiquitination | NAAEITDKLGLHSLR CHHHHHHHHCCHHHH | 35.49 | - | |
| 147 | Phosphorylation | TDKLGLHSLRQRNWY HHHHCCHHHHHCCCE | 30.23 | 25403869 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ARF2_RAT !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ARF2_RAT !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ARF2_RAT !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of ARF2_RAT !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...