UniProt ID | ARF2_RAT | |
---|---|---|
UniProt AC | P84082 | |
Protein Name | ADP-ribosylation factor 2 | |
Gene Name | Arf2 | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 181 | |
Subcellular Localization | Golgi apparatus. | |
Protein Description | GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. Involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus.. | |
Protein Sequence | MGNVFEKLFKSLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELTRMLAEDELRDAVLLVFVNKQDLPNAMNAAEITDKLGLHSLRQRNWYIQATCATSGDGLYEGLDWLSNQLKNQK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Myristoylation | ------MGNVFEKLF ------CCHHHHHHH | 38.72 | - | |
36 | Acetylation | GKTTILYKLKLGEIV CCEEEEEEEECCCEE | 35.38 | 31097137 | |
73 | Ubiquitination | WDVGGQDKIRPLWRH EECCCCCCCHHHHHH | 32.50 | - | |
142 | Acetylation | NAAEITDKLGLHSLR CHHHHHHHHCCHHHH | 35.49 | 66708769 | |
142 | Ubiquitination | NAAEITDKLGLHSLR CHHHHHHHHCCHHHH | 35.49 | - | |
147 | Phosphorylation | TDKLGLHSLRQRNWY HHHHCCHHHHHCCCE | 30.23 | 25403869 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ARF2_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ARF2_RAT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ARF2_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of ARF2_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...