dbPTM

NACC1_RAT - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	NACC1_RAT
UniProt AC	O35260
Protein Name	Nucleus accumbens-associated protein 1
Gene Name	Nacc1
Organism	Rattus norvegicus (Rat).
Sequence Length	514
Subcellular Localization	Nucleus. Cytoplasm. Punctate distribution in nucleus. In differentiated PC12 cells diffusely distributed in the cytoplasm and is dependent on phosphorylation.
Protein Description	Functions as a transcriptional repressor. Isoform 1 is a stronger transcriptional repressor than isoform 2. Seems to function as a transcriptional corepressor in neuronal cells through recruitment of HDAC3 and HDAC4. Contributes to tumor progression, and tumor cell proliferation and survival. This may be mediated at least in part through repressing transcriptional activity of GADD45GIP1. Required for recruiting the proteasome from the nucleus to the cytoplasm and dendritic spines..
Protein Sequence	MAQTLQMEIPNFGNSILECLNEQRLQGLYCDVSVVVKGHAFKAHRAVLAASSSYFRDLFNSSRSAVVELPAAVQPQSFQQILTFCYTGRLSMNMGDQFLLIYTAGFLQIQEIMEKGTEFFLKVSSPSCDSQGLHPEEAPSSEPQSPVAQILGWPACSTPLPLVSRVKTEQELDSVQCTPMAKRLWDSSQKEAGGSGGNNGSRKMAKFSTPDLAPNRMPQPVSVATATAAVAVVAVGGCVSGPSMSERTSPGTSSAYTSDSPSSYHNEEDEEEDAGEEGTDEQYRQICNMYTMYSMLNVGQTVEKVEALPEQVVLESHSRIRVRQDLASLPAELINQIGNRCHPKLYDEGDPSEKLELVTGTNVYITRAQLMNCHVSAGTRHKVLLRRLLASFFDRNTLANSCGTGIRSSTNDPRRKPLDSRVLHAVKYYCQNFAPNFKESEMNAIAADMCTNARRVVRKSWLPKTKPLHLVEGDNYSSFISDTGKIEPDMMSMEHSFETASHDGEAGPSAEVLQ

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
187	Phosphorylation	MAKRLWDSSQKEAGG HHHHHHHCCCHHHCC	24.08	-
208	Phosphorylation	SRKMAKFSTPDLAPN CCCCCCCCCCCCCCC	38.02	27097102
209	Phosphorylation	RKMAKFSTPDLAPNR CCCCCCCCCCCCCCC	24.77	27097102
245	Phosphorylation	CVSGPSMSERTSPGT HHCCCCCCCCCCCCC	28.41	16045493
476	Phosphorylation	HLVEGDNYSSFISDT EEECCCCCHHHHCCC	15.49	27097102
477	Phosphorylation	LVEGDNYSSFISDTG EECCCCCHHHHCCCC	25.65	28432305
478	Phosphorylation	VEGDNYSSFISDTGK ECCCCCHHHHCCCCC	19.08	28432305
481	Phosphorylation	DNYSSFISDTGKIEP CCCHHHHCCCCCCCC	27.40	28432305
483	Phosphorylation	YSSFISDTGKIEPDM CHHHHCCCCCCCCCC	33.32	27097102
492	Phosphorylation	KIEPDMMSMEHSFET CCCCCCCCCCCEEEC	17.87	27097102
496	Phosphorylation	DMMSMEHSFETASHD CCCCCCCEEECCCCC	16.09	27097102
499	Phosphorylation	SMEHSFETASHDGEA CCCCEEECCCCCCCC	31.30	27097102
501	Phosphorylation	EHSFETASHDGEAGP CCEEECCCCCCCCCC	29.54	27097102

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
245	S	Phosphorylation	Kinase	PKC-FAMILY	-	GPS
245	S	Phosphorylation	Kinase	PKC	-	Uniprot

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of NACC1_RAT !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of NACC1_RAT !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of NACC1_RAT !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of NACC1_RAT

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Activity-dependent subcellular localization of NAC1."; Korutla L., Champtiaux N., Shen H.-W., Klugmann M., Kalivas P.W.,Mackler S.A.; Eur. J. Neurosci. 22:397-403(2005). Cited for: SUBCELLULAR LOCATION, AND PHOSPHORYLATION AT SER-245.	16045493 [Abstract]