UniProt ID | PROF1_RAT | |
---|---|---|
UniProt AC | P62963 | |
Protein Name | Profilin-1 | |
Gene Name | Pfn1 | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 140 | |
Subcellular Localization | Cytoplasm, cytoskeleton. | |
Protein Description | Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG. Inhibits androgen receptor (AR) and HTT aggregation and binding of G-actin is essential for its inhibition of AR (By similarity).. | |
Protein Sequence | MAGWNAYIDSLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVSITPAEVGVLVGKDRSSFFVNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNVTVTMTAKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQY | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MAGWNAYID ------CCCHHHHHH | 31.54 | - | |
28 | Phosphorylation | AIVGYKDSPSVWAAV EEEEECCCCCEEEEC | 18.21 | 22673903 | |
30 | Phosphorylation | VGYKDSPSVWAAVPG EEECCCCCEEEECCC | 33.95 | 22673903 | |
39 | Phosphorylation | WAAVPGKTFVSITPA EEECCCCEEEEECHH | 34.87 | 23984901 | |
42 | Phosphorylation | VPGKTFVSITPAEVG CCCCEEEEECHHHEE | 19.29 | 23984901 | |
44 | Phosphorylation | GKTFVSITPAEVGVL CCEEEEECHHHEEEE | 14.67 | 23984901 | |
54 | Acetylation | EVGVLVGKDRSSFFV HEEEEEECCCCCEEE | 42.35 | 22902405 | |
57 | Phosphorylation | VLVGKDRSSFFVNGL EEEECCCCCEEECCE | 41.45 | 22673903 | |
58 | Phosphorylation | LVGKDRSSFFVNGLT EEECCCCCEEECCEE | 24.49 | 22673903 | |
65 | Phosphorylation | SFFVNGLTLGGQKCS CEEECCEEECCEEEE | 25.42 | 23984901 | |
70 | Ubiquitination | GLTLGGQKCSVIRDS CEEECCEEEEEEEHH | 31.58 | - | |
85 | Phosphorylation | LLQDGEFTMDLRTKS HCCCCEEEEEEEECC | 12.89 | 23984901 | |
108 | Acetylation | VTVTMTAKTLVLLMG EEEEECCCEEEEHHC | 32.97 | - | |
126 | Ubiquitination | VHGGLINKKCYEMAS CCCCCCCHHHHHHHH | 36.91 | - | |
129 | Phosphorylation | GLINKKCYEMASHLR CCCCHHHHHHHHHHH | 20.02 | - | |
138 | Phosphorylation | MASHLRRSQY----- HHHHHHHHCC----- | 27.65 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
138 | S | Phosphorylation | Kinase | ROCK1 | Q63644 | Uniprot |
Modified Location | Modified Residue | Modification | Function | Reference |
---|---|---|---|---|
138 | S | Phosphorylation |
| - |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PROF1_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of PROF1_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...