| UniProt ID | RAB14_RAT | |
|---|---|---|
| UniProt AC | P61107 | |
| Protein Name | Ras-related protein Rab-14 | |
| Gene Name | Rab14 | |
| Organism | Rattus norvegicus (Rat). | |
| Sequence Length | 215 | |
| Subcellular Localization |
Recycling endosome . Early endosome membrane Lipid-anchor Cytoplasmic side . Golgi apparatus membrane Lipid-anchor Cytoplasmic side . Golgi apparatus, trans-Golgi network membrane Lipid-anchor Cytoplasmic side . Cytoplasmic vesicle, phagosome |
|
| Protein Description | Regulates, together with its guanine nucleotide exchange factor, DENND6A, the specific endocytic transport of ADAM10, N-cadherin/CDH2 shedding and cell-cell adhesion (By similarity). Involved in membrane trafficking between the Golgi complex and endosomes during early embryonic development. Regulates the Golgi to endosome transport of FGFR-containing vesicles during early development, a key process for developing basement membrane and epiblast and primitive endoderm lineages during early postimplantation development. May act by modulating the kinesin KIF16B-cargo association to endosomes.. | |
| Protein Sequence | MATTPYNYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQREGCGC | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MATTPYNYS ------CCCCCCCHH | 21.85 | - | |
| 6 | Phosphorylation | --MATTPYNYSYIFK --CCCCCCCHHHEEE | 25.33 | 24972320 | |
| 8 | Phosphorylation | MATTPYNYSYIFKYI CCCCCCCHHHEEEEE | 9.30 | 24972320 | |
| 10 | Phosphorylation | TTPYNYSYIFKYIII CCCCCHHHEEEEEEE | 10.46 | 24972320 | |
| 61 | Acetylation | EVSGQKIKLQIWDTA EECCCEEEEEEECCC | 41.18 | 22902405 | |
| 61 | Ubiquitination | EVSGQKIKLQIWDTA EECCCEEEEEEECCC | 41.18 | - | |
| 97 | Phosphorylation | VYDITRRSTYNHLSS EEECCCCHHHHHHHH | 31.77 | 22673903 | |
| 98 | Phosphorylation | YDITRRSTYNHLSSW EECCCCHHHHHHHHH | 26.91 | 22673903 | |
| 99 | Phosphorylation | DITRRSTYNHLSSWL ECCCCHHHHHHHHHH | 11.22 | 28689409 | |
| 170 | Acetylation | DAFLEAAKKIYQNIQ HHHHHHHHHHHHHHC | 46.91 | 22902405 | |
| 170 | Ubiquitination | DAFLEAAKKIYQNIQ HHHHHHHHHHHHHHC | 46.91 | - | |
| 173 | Phosphorylation | LEAAKKIYQNIQDGS HHHHHHHHHHHCCCC | 12.37 | 28689409 | |
| 180 | Phosphorylation | YQNIQDGSLDLNAAE HHHHCCCCCCCCHHH | 27.31 | 28432305 | |
| 188 | Phosphorylation | LDLNAAESGVQHKPS CCCCHHHHCCCCCCC | 39.27 | 25575281 | |
| 193 | Ubiquitination | AESGVQHKPSAPQGG HHHCCCCCCCCCCCC | 24.47 | - | |
| 203 | Phosphorylation | APQGGRLTSEPQPQR CCCCCCCCCCCCCCC | 29.68 | 30181290 | |
| 204 | Phosphorylation | PQGGRLTSEPQPQRE CCCCCCCCCCCCCCC | 52.45 | 30181290 | |
| 213 | Geranylgeranylation | PQPQREGCGC----- CCCCCCCCCC----- | 4.27 | - | |
| 215 | Methylation | PQREGCGC------- CCCCCCCC------- | 6.15 | - | |
| 215 | Geranylgeranylation | PQREGCGC------- CCCCCCCC------- | 6.15 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RAB14_RAT !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RAB14_RAT !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RAB14_RAT !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of RAB14_RAT !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...