UniProt ID | RANT_RAT | |
---|---|---|
UniProt AC | Q8K586 | |
Protein Name | GTP-binding nuclear protein Ran, testis-specific isoform | |
Gene Name | Rasl2-9 | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 216 | |
Subcellular Localization | Nucleus . | |
Protein Description | GTP-binding protein involved in nucleocytoplasmic transport. Required for the import of protein into the nucleus and also for RNA export. Involved in chromatin condensation and control of cell cycle (By similarity).. | |
Protein Sequence | MAGQGKPQIQFKLVLVGDGGTGKTTFMKRHLTGEFEKEYVATLGVEVHTLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPSWHKDLVRVCENIPIVLCGNKVDIKDMKVKAKPILFHRKKNLQYYDISAKSNYNFEKPFFWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTTALPDEEDDL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MAGQGKPQI ------CCCCCCCEE | 21.00 | - | |
24 | Phosphorylation | GDGGTGKTTFMKRHL ECCCCCCCCCHHHHC | 26.98 | - | |
60 | Acetylation | HTNRGPIKFNVWDTA ECCCCCEEEEEEECC | 33.74 | 66739523 | |
71 | Acetylation | WDTAGQEKFGGLRDG EECCCCCCCCCCCCC | 41.23 | - | |
99 | Acetylation | VTSRVTYKNVPSWHK CCCCCEECCCCHHHH | 41.94 | - | |
134 | Acetylation | KDMKVKAKPILFHRK HHCCEECEEEEEEEC | 27.20 | - | |
152 | Acetylation | QYYDISAKSNYNFEK CEEECCCCCCCCCCC | 32.23 | - | |
159 | Acetylation | KSNYNFEKPFFWLAR CCCCCCCCHHHHHHH | 42.88 | - | |
159 | Succinylation | KSNYNFEKPFFWLAR CCCCCCCCHHHHHHH | 42.88 | - | |
159 | Succinylation | KSNYNFEKPFFWLAR CCCCCCCCHHHHHHH | 42.88 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RANT_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RANT_RAT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RANT_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RANT_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...