UniProt ID | XPP1_RAT | |
---|---|---|
UniProt AC | O54975 | |
Protein Name | Xaa-Pro aminopeptidase 1 | |
Gene Name | Xpnpep1 {ECO:0000312|RGD:621274} | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 623 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | Contributes to the degradation of bradykinin. Catalyzes the removal of a penultimate prolyl residue from the N-termini of peptides, such as Arg-Pro-Pro (By similarity).. | |
Protein Sequence | MAPKVTSELLRQLRQAMRNSECVAEPIQAYIIPSGDAHQSEYIAPCDCRRAFVSGFDGSAGTAIITEEHAAMWTDGRYFLQAAKQMDNNWTLMKMGLKDTPTQEDWLVSVLPEGSRVGVDPLIIPTDYWKKMAKVLRSAGHHLVPVKENLVDKIWTDRPERPCKPLLTLGLDYTGISWKEKVADLRLKMAERSIVWFVVTALDEIAWLFNLRGSDVEHNPVFFSYAIIGLERIMLFIDGDRIDAPGVKQHLLLDLGLEAEYKIQVLPYKSILSELKTLCADLSPREKVWVSDKASYAVSEAIPKDHRCCMPYTPICIAKAVKNSAESAGMRRAHIKDAVALCELFNWLEQEVPKGGVTEISAADKAEEFRRQQADFVDLSFPTISSTGPNGAIIHYAPIPETNRTLSLDEVYLIDSGAQYKDGTTDVTRTMHFGTPTAYEKECFTYVLKGHIAVSAAVFPTGTKGHLLDSFARSALWDSGLDYLHGTGHGVGSFLNVHEGPCGISYKTFSDEPLEAGMIVTDEPGYYEDGAFGIRIENVVLVVPAKTKYNFNNRGSLTFEPLTLVPIQTKMIDVDALTDKECDWLNSYHQTCRDVIGKELQTQGRQEALEWLLRETEPISRQH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
128 | Phosphorylation | PLIIPTDYWKKMAKV CEECCHHHHHHHHHH | 22.93 | - | |
130 | Acetylation | IIPTDYWKKMAKVLR ECCHHHHHHHHHHHH | 26.83 | 22902405 | |
134 | Acetylation | DYWKKMAKVLRSAGH HHHHHHHHHHHHCCC | 38.00 | 22902405 | |
147 | Acetylation | GHHLVPVKENLVDKI CCCCEECCHHHHHHH | 34.51 | 22902405 | |
287 | Acetylation | ADLSPREKVWVSDKA CCCCCCCCEEECCHH | 42.55 | 22902405 | |
293 | Acetylation | EKVWVSDKASYAVSE CCEEECCHHHHHHHH | 31.55 | 22902405 | |
304 | Acetylation | AVSEAIPKDHRCCMP HHHHHCCCCCCCCCC | 61.11 | 22902405 | |
324 | Phosphorylation | IAKAVKNSAESAGMR HHHHHHCHHHHHCCC | 27.91 | 26022182 | |
546 | Ubiquitination | VVLVVPAKTKYNFNN EEEEEECCCEECCCC | 39.21 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of XPP1_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of XPP1_RAT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of XPP1_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of XPP1_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...