| UniProt ID | XPP1_RAT | |
|---|---|---|
| UniProt AC | O54975 | |
| Protein Name | Xaa-Pro aminopeptidase 1 | |
| Gene Name | Xpnpep1 {ECO:0000312|RGD:621274} | |
| Organism | Rattus norvegicus (Rat). | |
| Sequence Length | 623 | |
| Subcellular Localization | Cytoplasm . | |
| Protein Description | Contributes to the degradation of bradykinin. Catalyzes the removal of a penultimate prolyl residue from the N-termini of peptides, such as Arg-Pro-Pro (By similarity).. | |
| Protein Sequence | MAPKVTSELLRQLRQAMRNSECVAEPIQAYIIPSGDAHQSEYIAPCDCRRAFVSGFDGSAGTAIITEEHAAMWTDGRYFLQAAKQMDNNWTLMKMGLKDTPTQEDWLVSVLPEGSRVGVDPLIIPTDYWKKMAKVLRSAGHHLVPVKENLVDKIWTDRPERPCKPLLTLGLDYTGISWKEKVADLRLKMAERSIVWFVVTALDEIAWLFNLRGSDVEHNPVFFSYAIIGLERIMLFIDGDRIDAPGVKQHLLLDLGLEAEYKIQVLPYKSILSELKTLCADLSPREKVWVSDKASYAVSEAIPKDHRCCMPYTPICIAKAVKNSAESAGMRRAHIKDAVALCELFNWLEQEVPKGGVTEISAADKAEEFRRQQADFVDLSFPTISSTGPNGAIIHYAPIPETNRTLSLDEVYLIDSGAQYKDGTTDVTRTMHFGTPTAYEKECFTYVLKGHIAVSAAVFPTGTKGHLLDSFARSALWDSGLDYLHGTGHGVGSFLNVHEGPCGISYKTFSDEPLEAGMIVTDEPGYYEDGAFGIRIENVVLVVPAKTKYNFNNRGSLTFEPLTLVPIQTKMIDVDALTDKECDWLNSYHQTCRDVIGKELQTQGRQEALEWLLRETEPISRQH | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 128 | Phosphorylation | PLIIPTDYWKKMAKV CEECCHHHHHHHHHH | 22.93 | - | |
| 130 | Acetylation | IIPTDYWKKMAKVLR ECCHHHHHHHHHHHH | 26.83 | 22902405 | |
| 134 | Acetylation | DYWKKMAKVLRSAGH HHHHHHHHHHHHCCC | 38.00 | 22902405 | |
| 147 | Acetylation | GHHLVPVKENLVDKI CCCCEECCHHHHHHH | 34.51 | 22902405 | |
| 287 | Acetylation | ADLSPREKVWVSDKA CCCCCCCCEEECCHH | 42.55 | 22902405 | |
| 293 | Acetylation | EKVWVSDKASYAVSE CCEEECCHHHHHHHH | 31.55 | 22902405 | |
| 304 | Acetylation | AVSEAIPKDHRCCMP HHHHHCCCCCCCCCC | 61.11 | 22902405 | |
| 324 | Phosphorylation | IAKAVKNSAESAGMR HHHHHHCHHHHHCCC | 27.91 | 26022182 | |
| 546 | Ubiquitination | VVLVVPAKTKYNFNN EEEEEECCCEECCCC | 39.21 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of XPP1_RAT !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of XPP1_RAT !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of XPP1_RAT !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of XPP1_RAT !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...