EF1G_RAT - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: EF1G_RAT
• UniProt AC: Q68FR6
• Protein Name: Elongation factor 1-gamma
• Gene Name: Eef1g
• Organism: Rattus norvegicus (Rat).
• Sequence Length: 437
• Protein Description: Probably plays a role in anchoring the complex to other cellular components..
• Protein Sequence: MAAGTLYTYPENWRAFKALIAAQYSGAQIRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVFESNAIAYYVSNEELRGSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGIMHHNKQATENAKEEVKRILGLLDTHLKTRTFLVGERVTLADITVVCTLLWLYKQVLEPSFRQAFPNTNRWFLTCINQPQFRAILGEVKLCEKMAQFDAKKFAESQPKKDTPRKEKGSREEKQKPQTERKEEKKAAAPAPEEEMDECEQALAAEPKAKDPFAHLPKSTFVLDEFKRKYSNEDTLSVALPYFWEHFDKDGWSLWYAEYRFPEELTQTFMSCNLITGMFQRLDKLRKNAFASVILFGTNNSSSISGVWVFRGQDLAFPLSPDWQVDYESYTWRKLDPGSEETQTLVREYFSWEGAFQHVGKAVNQGKIFK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MAAGTLYTY ------CCCCCEECC	18.01	-
43	Phosphorylation	PHFHFGQTNRTPEFL CCCCCCCCCCCHHHH	27.35	28432305
46	Phosphorylation	HFGQTNRTPEFLRKF CCCCCCCCHHHHHHC	29.28	27097102
132	Acetylation	KQATENAKEEVKRIL HHHHHHHHHHHHHHH	67.02	22902405
136	Acetylation	ENAKEEVKRILGLLD HHHHHHHHHHHHHHH	36.68	22902405
147	Acetylation	GLLDTHLKTRTFLVG HHHHHCCCCCEEECC	28.49	25786129
179	Phosphorylation	YKQVLEPSFRQAFPN HHHHHCHHHHHHCCC	24.56	30181290
212	Acetylation	GEVKLCEKMAQFDAK HHHHHHHHHHHHCHH	38.24	-
277	Succinylation	LAAEPKAKDPFAHLP HHHCCCCCCCCCCCC	72.55	26843850
277	Acetylation	LAAEPKAKDPFAHLP HHHCCCCCCCCCCCC	72.55	22902405
294	Acetylation	TFVLDEFKRKYSNED CEEHHHHHHHCCCCC	46.03	22902405
297	Phosphorylation	LDEFKRKYSNEDTLS HHHHHHHCCCCCCHH	22.29	23984901
298	Phosphorylation	DEFKRKYSNEDTLSV HHHHHHCCCCCCHHH	36.46	23298284
302	Phosphorylation	RKYSNEDTLSVALPY HHCCCCCCHHHHHHH	18.11	23984901
304	Phosphorylation	YSNEDTLSVALPYFW CCCCCCHHHHHHHHH	13.87	23984901
401	Acetylation	YESYTWRKLDPGSEE CCEEEEEECCCCCHH	49.13	-
401	Succinylation	YESYTWRKLDPGSEE CCEEEEEECCCCCHH	49.13	26843850
406	Phosphorylation	WRKLDPGSEETQTLV EEECCCCCHHHHHHH	37.33	25575281
409	Phosphorylation	LDPGSEETQTLVREY CCCCCHHHHHHHHHH	23.85	25575281
411	Phosphorylation	PGSEETQTLVREYFS CCCHHHHHHHHHHHC	34.34	25575281
434	N6-malonyllysine	GKAVNQGKIFK---- HHHHHCCCCCC----	34.89	-
434	Acetylation	GKAVNQGKIFK---- HHHHHCCCCCC----	34.89	25786129
434	Malonylation	GKAVNQGKIFK---- HHHHHCCCCCC----	34.89	-
437	Acetylation	VNQGKIFK------- HHCCCCCC-------	64.00	26302492

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
298	S	Phosphorylation	Kinase	PRKACA	P00517	GPS

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of EF1G_RAT !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of EF1G_RAT !!

Protein-Protein Interaction

Oops, there are no PPI records of EF1G_RAT !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.