SUMO1_RAT - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SUMO1_RAT
• UniProt AC: Q5I0H3
• Protein Name: Small ubiquitin-related modifier 1
• Gene Name: Sumo1
• Organism: Rattus norvegicus (Rat).
• Sequence Length: 101
• Subcellular Localization: Nucleus membrane. Nucleus speckle. Cytoplasm. Nucleus, PML body. Cell membrane . Nucleus . Recruited by BCL11A into the nuclear body. In the presence of ZFHX3, sequesterd to nuclear body (NB)-like dots in the nucleus some of which overlap or closely
• Protein Description: Ubiquitin-like protein that can be covalently attached to proteins as a monomer or a lysine-linked polymer. Covalent attachment via an isopeptide bond to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I, and can be promoted by E3 ligases such as PIAS1-4, RANBP2 or CBX4. This post-translational modification on lysine residues of proteins plays a crucial role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. Involved for instance in targeting RANGAP1 to the nuclear pore complex protein RANBP2. Covalently attached to the voltage-gated potassium channel KCNB1; this modulates the gating characteristics of KCNB1. Polymeric SUMO1 chains are also susceptible to polyubiquitination which functions as a signal for proteasomal degradation of modified proteins. May also regulate a network of genes involved in palate development. Covalently attached to ZFHX3..
• Protein Sequence: MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MSDQEAKPS ------CCCCCCCCC	48.26	-
2	Phosphorylation	------MSDQEAKPS ------CCCCCCCCC	48.26	30411139
7	Acetylation	-MSDQEAKPSTEDLG -CCCCCCCCCCCCCC	38.45	22902405
9	Phosphorylation	SDQEAKPSTEDLGDK CCCCCCCCCCCCCCC	43.66	23298284
10	Phosphorylation	DQEAKPSTEDLGDKK CCCCCCCCCCCCCCC	41.88	23298284
16	Acetylation	STEDLGDKKEGEYIK CCCCCCCCCCCCEEE	51.42	22902405
23	Acetylation	KKEGEYIKLKVIGQD CCCCCEEEEEEECCC	41.16	22902405
31	Phosphorylation	LKVIGQDSSEIHFKV EEEECCCCCEEEEEE	23.22	23984901
32	Phosphorylation	KVIGQDSSEIHFKVK EEECCCCCEEEEEEE	49.19	23984901

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SUMO1_RAT !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SUMO1_RAT !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SUMO1_RAT !!

Protein-Protein Interaction

Oops, there are no PPI records of SUMO1_RAT !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.