| UniProt ID | SOX10_RAT | |
|---|---|---|
| UniProt AC | O55170 | |
| Protein Name | Transcription factor SOX-10 | |
| Gene Name | Sox10 | |
| Organism | Rattus norvegicus (Rat). | |
| Sequence Length | 466 | |
| Subcellular Localization |
Cytoplasm . Nucleus . Mitochondrion outer membrane Peripheral membrane protein Cytoplasmic side . |
|
| Protein Description | Transcription factor that plays a central role in developing and mature glia. Specifically activates expression of myelin genes, during oligodendrocyte (OL) maturation, such as DUSP15 and MYRF, thereby playing a central role in oligodendrocyte maturation and CNS myelination. Once induced, MYRF cooperates with SOX10 to implement the myelination program. Transcriptional activator of MITF, acting synergistically with PAX3 (By similarity).. | |
| Protein Sequence | MAEEQDLSEVELSPVGSEEPRCLSPSSAPSLGPDGGGGGSGLRASPGPGELGKVKKEQQDGEADDDKFPVCIREAVSQVLSGYDWTLVPMPVRVNGASKSKPHVKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLNESDKRPFIEEAERLRMQHKKDHPDYKYQPRRRKNGKAAQGEAECPGGETDQGGAAAIQAHYKSAHLDHRHPEEGSPMSDGNPEHPSGQSHGPPTPPTTPKTELQSGKADPKRDGRSLGEGGKPHIDFGNVDIGEISHEVMSNMETFDVTELDQYLPPNGHPGHVGSYSAAGYGLSSALAVASGHSAWISKPPGVALPTVSPPAVDAKAQVKTETTGPQGPPHYTDQPSTSQIAYTSLSLPHYGSAFPSISRPQFDYSDHQPSGPYYGHAGQASGLYSAFSYMGPSQRPLYTAISDPSPSGPQSHSPTHWEQPVYTTLSRP | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 24 | Phosphorylation | SEEPRCLSPSSAPSL CCCCCCCCCCCCCCC | 26.76 | 27097102 | |
| 26 | Phosphorylation | EPRCLSPSSAPSLGP CCCCCCCCCCCCCCC | 35.44 | 27097102 | |
| 27 | Phosphorylation | PRCLSPSSAPSLGPD CCCCCCCCCCCCCCC | 47.81 | 27097102 | |
| 30 | Phosphorylation | LSPSSAPSLGPDGGG CCCCCCCCCCCCCCC | 45.75 | 27097102 | |
| 40 | Phosphorylation | PDGGGGGSGLRASPG CCCCCCCCCCCCCCC | 37.62 | 27097102 | |
| 45 | Phosphorylation | GGSGLRASPGPGELG CCCCCCCCCCCCCCC | 24.77 | 27097102 | |
| 140 | Acetylation | ELSKTLGKLWRLLNE HHHHHHHHHHHHHCC | 48.25 | 72536005 | |
| 221 | Phosphorylation | HRHPEEGSPMSDGNP CCCCCCCCCCCCCCC | 22.25 | 27097102 | |
| 224 | Phosphorylation | PEEGSPMSDGNPEHP CCCCCCCCCCCCCCC | 45.83 | 27097102 | |
| 232 | Phosphorylation | DGNPEHPSGQSHGPP CCCCCCCCCCCCCCC | 51.91 | 27097102 | |
| 235 | Phosphorylation | PEHPSGQSHGPPTPP CCCCCCCCCCCCCCC | 33.66 | 27097102 | |
| 240 | Phosphorylation | GQSHGPPTPPTTPKT CCCCCCCCCCCCCCH | 45.06 | 27097102 | |
| 243 | Phosphorylation | HGPPTPPTTPKTELQ CCCCCCCCCCCHHHC | 57.86 | 27097102 | |
| 244 | Phosphorylation | GPPTPPTTPKTELQS CCCCCCCCCCHHHCC | 28.67 | 27097102 | |
| 440 | Phosphorylation | RPLYTAISDPSPSGP CCCEEECCCCCCCCC | 40.79 | 27097102 | |
| 443 | Phosphorylation | YTAISDPSPSGPQSH EEECCCCCCCCCCCC | 36.37 | 27097102 | |
| 445 | Phosphorylation | AISDPSPSGPQSHSP ECCCCCCCCCCCCCC | 68.40 | 27097102 | |
| 449 | Phosphorylation | PSPSGPQSHSPTHWE CCCCCCCCCCCCCCC | 29.12 | 27097102 | |
| 451 | Phosphorylation | PSGPQSHSPTHWEQP CCCCCCCCCCCCCCC | 36.42 | 27097102 | |
| 453 | Phosphorylation | GPQSHSPTHWEQPVY CCCCCCCCCCCCCCE | 42.51 | 27097102 | |
| 460 | Phosphorylation | THWEQPVYTTLSRP- CCCCCCCEEECCCC- | 10.74 | 27097102 | |
| 461 | Phosphorylation | HWEQPVYTTLSRP-- CCCCCCEEECCCC-- | 22.84 | 27097102 | |
| 462 | Phosphorylation | WEQPVYTTLSRP--- CCCCCEEECCCC--- | 12.68 | 27097102 | |
| 464 | Phosphorylation | QPVYTTLSRP----- CCCEEECCCC----- | 40.18 | 27097102 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SOX10_RAT !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SOX10_RAT !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SOX10_RAT !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| PAX6_MOUSE | Pax6 | physical | 16582099 | |
| MEOX1_MOUSE | Meox1 | physical | 16582099 | |
| DLX5_MOUSE | Dlx5 | physical | 16582099 | |
| HHEX_MOUSE | Hhex | physical | 16582099 | |
| ALX4_MOUSE | Alx4 | physical | 16582099 | |
| HXA3_MOUSE | Hoxa3 | physical | 16582099 | |
| PO3F3_MOUSE | Pou3f3 | physical | 16582099 | |
| UTF1_MOUSE | Utf1 | physical | 16582099 | |
| HTF4_MOUSE | Tcf12 | physical | 16582099 | |
| OLIG2_MOUSE | Olig2 | physical | 16582099 | |
| JUN_MOUSE | Jun | physical | 16582099 | |
| CEBPA_MOUSE | Cebpa | physical | 16582099 | |
| EGR2_MOUSE | Egr2 | physical | 16582099 | |
| SP1_MOUSE | Sp1 | physical | 16582099 | |
| PAX3_MOUSE | Pax3 | physical | 16582099 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...