UniProt ID | SOX10_RAT | |
---|---|---|
UniProt AC | O55170 | |
Protein Name | Transcription factor SOX-10 | |
Gene Name | Sox10 | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 466 | |
Subcellular Localization |
Cytoplasm . Nucleus . Mitochondrion outer membrane Peripheral membrane protein Cytoplasmic side . |
|
Protein Description | Transcription factor that plays a central role in developing and mature glia. Specifically activates expression of myelin genes, during oligodendrocyte (OL) maturation, such as DUSP15 and MYRF, thereby playing a central role in oligodendrocyte maturation and CNS myelination. Once induced, MYRF cooperates with SOX10 to implement the myelination program. Transcriptional activator of MITF, acting synergistically with PAX3 (By similarity).. | |
Protein Sequence | MAEEQDLSEVELSPVGSEEPRCLSPSSAPSLGPDGGGGGSGLRASPGPGELGKVKKEQQDGEADDDKFPVCIREAVSQVLSGYDWTLVPMPVRVNGASKSKPHVKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLNESDKRPFIEEAERLRMQHKKDHPDYKYQPRRRKNGKAAQGEAECPGGETDQGGAAAIQAHYKSAHLDHRHPEEGSPMSDGNPEHPSGQSHGPPTPPTTPKTELQSGKADPKRDGRSLGEGGKPHIDFGNVDIGEISHEVMSNMETFDVTELDQYLPPNGHPGHVGSYSAAGYGLSSALAVASGHSAWISKPPGVALPTVSPPAVDAKAQVKTETTGPQGPPHYTDQPSTSQIAYTSLSLPHYGSAFPSISRPQFDYSDHQPSGPYYGHAGQASGLYSAFSYMGPSQRPLYTAISDPSPSGPQSHSPTHWEQPVYTTLSRP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
24 | Phosphorylation | SEEPRCLSPSSAPSL CCCCCCCCCCCCCCC | 26.76 | 27097102 | |
26 | Phosphorylation | EPRCLSPSSAPSLGP CCCCCCCCCCCCCCC | 35.44 | 27097102 | |
27 | Phosphorylation | PRCLSPSSAPSLGPD CCCCCCCCCCCCCCC | 47.81 | 27097102 | |
30 | Phosphorylation | LSPSSAPSLGPDGGG CCCCCCCCCCCCCCC | 45.75 | 27097102 | |
40 | Phosphorylation | PDGGGGGSGLRASPG CCCCCCCCCCCCCCC | 37.62 | 27097102 | |
45 | Phosphorylation | GGSGLRASPGPGELG CCCCCCCCCCCCCCC | 24.77 | 27097102 | |
140 | Acetylation | ELSKTLGKLWRLLNE HHHHHHHHHHHHHCC | 48.25 | 72536005 | |
221 | Phosphorylation | HRHPEEGSPMSDGNP CCCCCCCCCCCCCCC | 22.25 | 27097102 | |
224 | Phosphorylation | PEEGSPMSDGNPEHP CCCCCCCCCCCCCCC | 45.83 | 27097102 | |
232 | Phosphorylation | DGNPEHPSGQSHGPP CCCCCCCCCCCCCCC | 51.91 | 27097102 | |
235 | Phosphorylation | PEHPSGQSHGPPTPP CCCCCCCCCCCCCCC | 33.66 | 27097102 | |
240 | Phosphorylation | GQSHGPPTPPTTPKT CCCCCCCCCCCCCCH | 45.06 | 27097102 | |
243 | Phosphorylation | HGPPTPPTTPKTELQ CCCCCCCCCCCHHHC | 57.86 | 27097102 | |
244 | Phosphorylation | GPPTPPTTPKTELQS CCCCCCCCCCHHHCC | 28.67 | 27097102 | |
440 | Phosphorylation | RPLYTAISDPSPSGP CCCEEECCCCCCCCC | 40.79 | 27097102 | |
443 | Phosphorylation | YTAISDPSPSGPQSH EEECCCCCCCCCCCC | 36.37 | 27097102 | |
445 | Phosphorylation | AISDPSPSGPQSHSP ECCCCCCCCCCCCCC | 68.40 | 27097102 | |
449 | Phosphorylation | PSPSGPQSHSPTHWE CCCCCCCCCCCCCCC | 29.12 | 27097102 | |
451 | Phosphorylation | PSGPQSHSPTHWEQP CCCCCCCCCCCCCCC | 36.42 | 27097102 | |
453 | Phosphorylation | GPQSHSPTHWEQPVY CCCCCCCCCCCCCCE | 42.51 | 27097102 | |
460 | Phosphorylation | THWEQPVYTTLSRP- CCCCCCCEEECCCC- | 10.74 | 27097102 | |
461 | Phosphorylation | HWEQPVYTTLSRP-- CCCCCCEEECCCC-- | 22.84 | 27097102 | |
462 | Phosphorylation | WEQPVYTTLSRP--- CCCCCEEECCCC--- | 12.68 | 27097102 | |
464 | Phosphorylation | QPVYTTLSRP----- CCCEEECCCC----- | 40.18 | 27097102 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SOX10_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SOX10_RAT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SOX10_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PAX6_MOUSE | Pax6 | physical | 16582099 | |
MEOX1_MOUSE | Meox1 | physical | 16582099 | |
DLX5_MOUSE | Dlx5 | physical | 16582099 | |
HHEX_MOUSE | Hhex | physical | 16582099 | |
ALX4_MOUSE | Alx4 | physical | 16582099 | |
HXA3_MOUSE | Hoxa3 | physical | 16582099 | |
PO3F3_MOUSE | Pou3f3 | physical | 16582099 | |
UTF1_MOUSE | Utf1 | physical | 16582099 | |
HTF4_MOUSE | Tcf12 | physical | 16582099 | |
OLIG2_MOUSE | Olig2 | physical | 16582099 | |
JUN_MOUSE | Jun | physical | 16582099 | |
CEBPA_MOUSE | Cebpa | physical | 16582099 | |
EGR2_MOUSE | Egr2 | physical | 16582099 | |
SP1_MOUSE | Sp1 | physical | 16582099 | |
PAX3_MOUSE | Pax3 | physical | 16582099 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...