dbPTM

DLX5_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	DLX5_MOUSE
UniProt AC	P70396
Protein Name	Homeobox protein DLX-5
Gene Name	Dlx5
Organism	Mus musculus (Mouse).
Sequence Length	289
Subcellular Localization	Nucleus .
Protein Description	Transcriptional factor involved in bone development. Acts as an immediate early BMP-responsive transcriptional activator essential for osteoblast differentiation. Stimulates ALPL promoter activity in a RUNX2-independent manner during osteoblast differentiation. Stimulates SP7 promoter activity during osteoblast differentiation. Promotes cell proliferation by up-regulating MYC promoter activity. Involved as a positive regulator of both chondrogenesis and chondrocyte hypertrophy in the endochondral skeleton. Binds to the homeodomain-response element of the ALPL and SP7 promoter. Binds to the MYC promoter. Requires the 5'-TAATTA-3' consensus sequence for DNA-binding..
Protein Sequence	MTGVFDRRVPSIRSGDFQAPFPTSAAMHHPSQESPTLPESSATDSDYYSPAGAAPHGYCSPTSASYGKALNPYQYQYHGVNGSAAGYPAKAYADYGYASPYHQYGGAYNRVPSATSQPEKEVAEPEVRMVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNKRSKIKKIMKNGEMPPEHSPSSSDPMACNSPQSPAVWEPQGSSRSLSHHPHAHPPTSNQSPASSYLENSASWYPSAASSINSHLPPPGSLQHPLALASGTLY

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
34	Phosphorylation	MHHPSQESPTLPESS CCCCCCCCCCCCCCC	18.62	22817900
133	Acetylation	EVRMVNGKPKKVRKP CEEEECCCCCCCCCC	48.76	7744121
217	Phosphorylation	SDPMACNSPQSPAVW CCCCCCCCCCCCCCC	24.97	9415433

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
34	S	Phosphorylation	Kinase	MAPK14	Q16539	GPS
34	S	Phosphorylation	Kinase	MAPK14	P47811	Uniprot
217	S	Phosphorylation	Kinase	MAPK14	Q16539	GPS
217	S	Phosphorylation	Kinase	MAPK14	P47811	Uniprot

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Reference
34	S	Phosphorylation	18056716
Phosphorylation of Ser-34 and Ser-217 by MAPK14 enhances its transcriptional activity.
217	S	Phosphorylation	18056716
Phosphorylation of Ser-34 and Ser-217 by MAPK14 enhances its transcriptional activity.

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of DLX5_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
HXB13_MOUSE	Hoxb13	physical	20211142
NFE2_MOUSE	Nfe2	physical	20211142
HNF4G_MOUSE	Hnf4g	physical	20211142
JDP2_MOUSE	Jdp2	physical	20211142
SP7_MOUSE	Sp7	physical	20211142

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of DLX5_MOUSE

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"BMP-2 induces Osterix expression through up-regulation of Dlx5 andits phosphorylation by p38."; Ulsamer A., Ortuno M.J., Ruiz S., Susperregui A.R., Osses N.,Rosa J.L., Ventura F.; J. Biol. Chem. 283:3816-3826(2008). Cited for: FUNCTION, PHOSPHORYLATION AT SER-34 AND SER-217, MUTAGENESIS OF SER-34AND SER-217, SUBCELLULAR LOCATION, AND INDUCTION.	18056716 [Abstract]