dbPTM

JDP2_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	JDP2_MOUSE
UniProt AC	P97875
Protein Name	Jun dimerization protein 2
Gene Name	Jdp2
Organism	Mus musculus (Mouse).
Sequence Length	163
Subcellular Localization	Nucleus .
Protein Description	Component of the AP-1 transcription factor that represses transactivation mediated by the Jun family of proteins. Involved in a variety of transcriptional responses associated with AP-1, such as UV-induced apoptosis, cell differentiation, tumorigenesis and antitumogeneris. Can also function as a repressor by recruiting histone deacetylase 3/HDAC3 to the promoter region of JUN. May control transcription via direct regulation of the modification of histones and the assembly of chromatin (By similarity)..
Protein Sequence	MMPGQIPDPSVTAGSLPGLGPLTGLPSSALTTEELKYADIRNIGAMIAPLHFLEVKLGKRPQPVKSELDEEEERRKRRREKNKVAAARCRNKKKERTEFLQRESERLELMNAELKTQIEELKLERQQLILMLNRHRPTCIVRTDSVRTPESEGNPLLEQLDKK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
143	Phosphorylation	RPTCIVRTDSVRTPE CCCEEEECCCCCCCC	23.02	25619855
145	Phosphorylation	TCIVRTDSVRTPESE CEEEECCCCCCCCCC	16.94	27180971
148	Phosphorylation	VRTDSVRTPESEGNP EECCCCCCCCCCCCH	29.29	11602244
151	Phosphorylation	DSVRTPESEGNPLLE CCCCCCCCCCCHHHH	52.59	25619855

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
148	T	Phosphorylation	Kinase	JNK1	Q91Y86	PSP

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Reference
148	T	Oxidation	11602244
Phosphorylation of Thr-148 by MAPK8 in response to different stress conditions such as, UV irradiation, oxidatives stress and anisomycin treatments.
148	T	Phosphorylation	11602244
Phosphorylation of Thr-148 by MAPK8 in response to different stress conditions such as, UV irradiation, oxidatives stress and anisomycin treatments.

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of JDP2_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
JDP2_MOUSE	Jdp2	physical	20211142
TAF13_MOUSE	Taf13	physical	20211142
JDP2_MOUSE	Jdp2	physical	12052888
ATF2_MOUSE	Atf2	physical	12052888
HDAC1_MOUSE	Hdac1	physical	22989952
HDAC2_MOUSE	Hdac2	physical	22989952
ATF2_MOUSE	Atf2	physical	11231009

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of JDP2_MOUSE

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphorylation of two eukaryotic transcription factors, Jundimerization protein 2 and activation transcription factor 2, inEscherichia coli by Jun N-terminal kinase 1."; Murata T., Shinozuka Y., Obata Y., Yokoyama K.K.; Anal. Biochem. 376:115-121(2008). Cited for: INTERACTION WITH ATF2, PHOSPHORYLATION AT THR-148 BY MAPK8/JNK1, ANDMUTAGENESIS OF THR-148.	18307971 [Abstract]
"The AP-1 repressor, JDP2, is a bona fide substrate for the c-Jun N-terminal kinase."; Katz S., Heinrich R., Aronheim A.; FEBS Lett. 506:196-200(2001). Cited for: INTERACTION WITH ATF2, PHOSPHORYLATION AT THR-148 BY MAPK8, ANDMUTAGENESIS OF THR-148.	11602244 [Abstract]