UniProt ID | HXB13_MOUSE | |
---|---|---|
UniProt AC | P70321 | |
Protein Name | Homeobox protein Hox-B13 | |
Gene Name | Hoxb13 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 286 | |
Subcellular Localization | Nucleus. | |
Protein Description | Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Binds preferentially to methylated DNA (By similarity).. | |
Protein Sequence | MEPGNYATLDGAKDIEGLLGAGGGRNLVSHSSPLASHPAAPTLMPTVNYAPLDLPGSAEPPKQCHPCPGVPQGASPAPVPYGYFGGGYYSCRVSRSSLKPCAQTAALATYPSETPAPGEEYPSRPTEFAFYPGYPGPYQPMASYLDVSVVQTLGAPGEPRHDSLLPVDSYQPWALAGGWNSQMCCQGEQNPPGPFWKAAFAEPSVQHPPPDGCAFRRGRKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQNRRVKEKKVLAKVKTSTTP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of HXB13_MOUSE !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HXB13_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HXB13_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HXB13_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...