HXB13_MOUSE - dbPTM
HXB13_MOUSE - PTM Information in dbPTM
Basic Information of Protein
UniProt ID HXB13_MOUSE
UniProt AC P70321
Protein Name Homeobox protein Hox-B13
Gene Name Hoxb13
Organism Mus musculus (Mouse).
Sequence Length 286
Subcellular Localization Nucleus.
Protein Description Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Binds preferentially to methylated DNA (By similarity)..
Protein Sequence MEPGNYATLDGAKDIEGLLGAGGGRNLVSHSSPLASHPAAPTLMPTVNYAPLDLPGSAEPPKQCHPCPGVPQGASPAPVPYGYFGGGYYSCRVSRSSLKPCAQTAALATYPSETPAPGEEYPSRPTEFAFYPGYPGPYQPMASYLDVSVVQTLGAPGEPRHDSLLPVDSYQPWALAGGWNSQMCCQGEQNPPGPFWKAAFAEPSVQHPPPDGCAFRRGRKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQNRRVKEKKVLAKVKTSTTP
Overview of Protein Modification Sites with Functional and Structural Information
Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations Modification Substrate Peptides
&
Secondary Structure
ASA (%) Reference Orthologous
Protein Cluster

Oops, there are no PTM records of HXB13_MOUSE !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)
Modified Location Modified Residue Modification Type of Upstream Proteins Gene Name of Upstream Proteins UniProt AC of Upstream Proteins Sources

Oops, there are no upstream regulatory protein records of HXB13_MOUSE !!

Functions of PTM Sites
Modified Location Modified Residue Modification Function Reference

Oops, there are no descriptions of PTM sites of HXB13_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location Modification Variant Position
(Distance <= 10)
Residue Change SAP Related Disease Reference

Oops, there are no SNP-PTM records of HXB13_MOUSE !!

Protein-Protein Interaction
Interacting Protein Gene Name Interaction Type PPI Reference Domain-Domain Interactions

Drug and Disease Associations
Kegg Drug
DrugBank
There are no disease associations of PTM sites.
Regulatory Network of HXB13_MOUSE

loading...

Related Literatures of Post-Translational Modification

TOP