EGR2_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: EGR2_MOUSE
• UniProt AC: P08152
• Protein Name: E3 SUMO-protein ligase EGR2
• Gene Name: Egr2
• Organism: Mus musculus (Mouse).
• Sequence Length: 470
• Subcellular Localization: Nucleus .
• Protein Description: Sequence-specific DNA-binding transcription factor. Binds to two specific DNA sites located in the promoter region of HOXA4. Binds to the promoter region of ERBB2. May play a role in the regulation of hindbrain segmentation, might act in combination with the Hox network to specify odd and even rhombomeres, and might participate in the control of the expression of some of the homeobox containing genes.; E3 SUMO-protein ligase helping SUMO1 conjugation to its coregulators NAB1 and NAB2, whose sumoylation down-regulates EGR2 own transcriptional activity..
• Protein Sequence: MMTAKAVDKIPVTLSGFMHQLPDSLYPVEDLAASSVTIFPNGELGGPFDQMNGVAGDGMINIDMTGEKRPLDLPYPSSFAPISAPRNQTFTYMGKFSIDPQYPGASCYPEGIINIVSAGILQGVTPPASTTASSSVTSASPNPLATGPLGVCTMSQTQPELDHLYSPPPPPPPYSGCTGDLYQDPSAFLSPPSTTSTSSLAYQPPPSYPSPKPAMDPGLIPMIPDYPGFFPSPCQRDPHGAAGPDRKPFPCPLDSLRVPPPLTPLSTIRNFTLGGPGAGVTGPGASGGGEGPRLPGSGSAAVTATPYNPHHLPLRPILRPRKYPNRPSKTPVHERPYPCPAEGCDRRFSRSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDYCGRKFARSDERKRHTKIHLRQKERKSSAPSAPPSAQSSASGPGGSQAGGSLCGNSAIGGPLASCTSRTRTP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
65	Phosphorylation	GMINIDMTGEKRPLD CCEEEECCCCCCCCC	38.14	29550500
75	Phosphorylation	KRPLDLPYPSSFAPI CCCCCCCCCCCCCCC	24.04	28576409
247	Acetylation	GAAGPDRKPFPCPLD CCCCCCCCCCCCCHH	59.39	28576496
402	Methylation	FACDYCGRKFARSDE CCCCCCCCCCCCCHH	27.62	-
406	Methylation	YCGRKFARSDERKRH CCCCCCCCCHHHHHH	48.01	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
-	K	Ubiquitination	E3 ubiquitin ligase	Wwp2	Q9DBH0	PMID:22199232

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
247	K	Acetylation	Acetylated at Lys-247.	28576496

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of EGR2_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PIAS2_MOUSE	Pias2	physical	16675951

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.