dbPTM

HHEX_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	HHEX_MOUSE
UniProt AC	P43120
Protein Name	Hematopoietically-expressed homeobox protein Hhex
Gene Name	Hhex
Organism	Mus musculus (Mouse).
Sequence Length	271
Subcellular Localization	Nucleus .
Protein Description	Recognizes the DNA sequence 5'-ATTAA-3' (By similarity). Transcriptional repressor. May play a role in hematopoietic differentiation. Establishes anterior identity at two levels; acts early to enhance canonical WNT-signaling by repressing expression of TLE4, and acts later to inhibit NODAL-signaling by directly targeting NODAL..
Protein Sequence	MQFPHPGPAAAPAVGVPLYAPTPLLQPAHPTPFYIDDILGRGPAAPTPTPTLPSPNSSFTSLVSSYRTPVYEPTPVHPAFSHHPAAALAAAYGPSGFGGPLYPFPRTVNDYTHALLRHDPLGKPLLWSPFLQRPLHKRKGGQVRFSNDQTVELEKKFETQKYLSPPERKRLAKMLQLSERQVKTWFQNRRAKWRRLKQENPQSNKKDALDSLDTSCEQGQDLPSEQNKGASLDRSQCSPSPASQEDPDSEISEDSDQEVDIEGDKGYFNAG

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
54	Phosphorylation	TPTPTLPSPNSSFTS CCCCCCCCCCCCHHH	39.56	30352176
128	Phosphorylation	LGKPLLWSPFLQRPL CCCCCCCCHHHCCCC	13.02	-
169	Acetylation	YLSPPERKRLAKMLQ CCCHHHHHHHHHHHH	50.53	19850901
173	Ubiquitination	PERKRLAKMLQLSER HHHHHHHHHHHHHHH	44.74	22790023
240	Phosphorylation	DRSQCSPSPASQEDP CHHHCCCCCCCCCCC	19.46	25521595
249	Phosphorylation	ASQEDPDSEISEDSD CCCCCCCCCCCCCCC	42.07	25521595
252	Phosphorylation	EDPDSEISEDSDQEV CCCCCCCCCCCCCCE	31.16	25521595

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of HHEX_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of HHEX_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of HHEX_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
FOS_MOUSE	Fos	physical	11551904
JUN_MOUSE	Jun	physical	11551904
TF2AY_MOUSE	Gtf2a1l	physical	20211142
SP7_MOUSE	Sp7	physical	20211142

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of HHEX_MOUSE

Related Literatures of Post-Translational Modification