| UniProt ID | SAE1_RAT | |
|---|---|---|
| UniProt AC | Q6AXQ0 | |
| Protein Name | SUMO-activating enzyme subunit 1 | |
| Gene Name | Sae1 | |
| Organism | Rattus norvegicus (Rat). | |
| Sequence Length | 349 | |
| Subcellular Localization | Nucleus. | |
| Protein Description | The heterodimer acts as an E1 ligase for SUMO1, SUMO2, SUMO3, and probably SUMO4. It mediates ATP-dependent activation of SUMO proteins followed by formation of a thioester bond between a SUMO protein and a conserved active site cysteine residue on UBA2/SAE2 (By similarity).. | |
| Protein Sequence | MVEKEEVSGGGGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLIVGMKGLGAEIAKNLILAGVKGLTMLDHEQVSPEDLGAQFLIRTGSVGQNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTEFDAVCLTCCSKDVIIKVDQICHRNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTKVTKVSQGVEDGPDAKRAKLDSSETTMVKKKVLFCPVKEALAVDWSGEKAQAALKRTAPDYFLLQVLLKFRTDKGRDPTSDSYSEDAELLLQIRNDVFDSLGVSPDLLPDDFVRYCFSEMAPVCAVVGGILAQEIVKALSQRDPPHNNFFFFDGMKGSGIVECLGPQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 1 | Acetylation | -------MVEKEEVS -------CCCCEECC | 8.73 | - | |
| 2 | Acetylation | ------MVEKEEVSG ------CCCCEECCC | 16.88 | - | |
| 4 | Acetylation | ----MVEKEEVSGGG ----CCCCEECCCCC | 48.00 | 22902405 | |
| 8 | Phosphorylation | MVEKEEVSGGGGGIS CCCCEECCCCCCCCC | 34.69 | 30181290 | |
| 15 | Phosphorylation | SGGGGGISEEEAAQY CCCCCCCCHHHHHHH | 42.08 | 23984901 | |
| 35 | Acetylation | LWGLEAQKRLRASRV HHCHHHHHHHHHCEE | 61.52 | 22902405 | |
| 153 | Phosphorylation | DQICHRNSIKFFTGD HHHHHCCCCEEEECC | 27.41 | 23984901 | |
| 188 | Phosphorylation | KTKVTKVSQGVEDGP HHHEEEHHHCCCCCC | 23.83 | 28432305 | |
| 198 | Acetylation | VEDGPDAKRAKLDSS CCCCCCHHHHCCCCC | 61.34 | 22902405 | |
| 201 | Acetylation | GPDAKRAKLDSSETT CCCHHHHCCCCCCCC | 57.78 | 22902405 | |
| 204 | Phosphorylation | AKRAKLDSSETTMVK HHHHCCCCCCCCCCE | 40.28 | 23984901 | |
| 205 | Phosphorylation | KRAKLDSSETTMVKK HHHCCCCCCCCCCEE | 38.33 | 23984901 | |
| 207 | Phosphorylation | AKLDSSETTMVKKKV HCCCCCCCCCCEEEE | 23.34 | 23984901 | |
| 208 | Phosphorylation | KLDSSETTMVKKKVL CCCCCCCCCCEEEEE | 18.86 | 23984901 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SAE1_RAT !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SAE1_RAT !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SAE1_RAT !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of SAE1_RAT !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
