| UniProt ID | DX39B_RAT | |
|---|---|---|
| UniProt AC | Q63413 | |
| Protein Name | Spliceosome RNA helicase Ddx39b | |
| Gene Name | Ddx39b | |
| Organism | Rattus norvegicus (Rat). | |
| Sequence Length | 428 | |
| Subcellular Localization | Nucleus. Nucleus speckle. Cytoplasm. Can translocate to the cytoplasm in the presence of MX1.. | |
| Protein Description | Involved in nuclear export of spliced and unspliced mRNA. Assembling component of the TREX complex which is thought to couple mRNA transcription, processing and nuclear export, and specifically associates with spliced mRNA and not with unspliced pre-mRNA. TREX is recruited to spliced mRNAs by a transcription-independent mechanism, binds to mRNA upstream of the exon-junction complex (EJC) and is recruited in a splicing- and cap-dependent manner to a region near the 5' end of the mRNA where it functions in mRNA export to the cytoplasm via the TAP/NFX1 pathway. May undergo several rounds of ATP hydrolysis during assembly of TREX to drive subsequent loading of components such as ALYREF/THOC and CHTOP onto mRNA. Also associates with pre-mRNA independent of ALYREF/THOC4 and the THO complex. Involved in the nuclear export of intronless mRNA; the ATP-bound form is proposed to recruit export adapter ALYREF/THOC4 to intronless mRNA; its ATPase activity is cooperatively stimulated by RNA and ALYREF/THOC4 and ATP hydrolysis is thought to trigger the dissociation from RNA to allow the association of ALYREF/THOC4 and the NXF1-NXT1 heterodimer. Involved in transcription elongation and genome stability (By similarity).; Splice factor that is required for the first ATP-dependent step in spliceosome assembly and for the interaction of U2 snRNP with the branchpoint. Has both RNA-stimulated ATP binding/hydrolysis activity and ATP-dependent RNA unwinding activity. Even with the stimulation of RNA, the ATPase activity is weak. Can only hydrolyze ATP but not other NTPs. The RNA stimulation of ATPase activity does not have a strong preference for the sequence and length of the RNA. However, ssRNA stimulates the ATPase activity much more strongly than dsRNA. Can unwind 5' or 3' overhangs or blunt end RNA duplexes in vitro. The ATPase and helicase activities are not influenced by U2AF2; the effect of ALYREF/THOC4 is reported conflictingly (By similarity).. | |
| Protein Sequence | MAENDVDNELLDYEDDEVETAAGADGTEAPAKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKFMQDPMEIFVDDETKLTLHGLQQYYVKLKDNEKNRKLFDLLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMPQEERLSRYQQFKDFQRRILVATNLFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISELPDEIDISSYIEQTR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MAENDVDNE ------CCCCCCCCC | 25.05 | - | |
| 13 | Phosphorylation | VDNELLDYEDDEVET CCCCCCCCCCCCCCC | 22.64 | 21373199 | |
| 32 | Acetylation | DGTEAPAKKDVKGSY CCCCCCCCCCCCCCE | 48.74 | 22902405 | |
| 36 | Acetylation | APAKKDVKGSYVSIH CCCCCCCCCCEEEEE | 52.88 | 72533283 | |
| 38 | Phosphorylation | AKKDVKGSYVSIHSS CCCCCCCCEEEEECC | 19.35 | 27097102 | |
| 39 | Phosphorylation | KKDVKGSYVSIHSSG CCCCCCCEEEEECCC | 13.59 | 25575281 | |
| 41 | Phosphorylation | DVKGSYVSIHSSGFR CCCCCEEEEECCCCH | 13.32 | 23984901 | |
| 44 | Phosphorylation | GSYVSIHSSGFRDFL CCEEEEECCCCHHHH | 30.41 | 23984901 | |
| 45 | Phosphorylation | SYVSIHSSGFRDFLL CEEEEECCCCHHHHC | 27.99 | 23984901 | |
| 53 | Acetylation | GFRDFLLKPELLRAI CCHHHHCCHHHHHHH | 38.30 | 72533285 | |
| 156 | Succinylation | FGGLSIKKDEEVLKK ECCCCCCCCHHHHHH | 69.56 | 26843850 | |
| 162 | Acetylation | KKDEEVLKKNCPHIV CCCHHHHHHCCCEEE | 47.30 | 22902405 | |
| 172 | Phosphorylation | CPHIVVGTPGRILAL CCEEEECCHHHHHHH | 15.80 | 23984901 | |
| 188 | Acetylation | RNKSLNLKHIKHFIL CCCCCCHHHHHHHHH | 42.06 | 22902405 | |
| 218 | Phosphorylation | VQEIFRMTPHEKQVM HHHHHHCCHHHHHHH | 19.76 | 25575281 | |
| 228 | Phosphorylation | EKQVMMFSATLSKEI HHHHHHEEECCCHHH | 11.49 | 25575281 | |
| 230 | Phosphorylation | QVMMFSATLSKEIRP HHHHEEECCCHHHHH | 30.30 | 25575281 | |
| 232 | Phosphorylation | MMFSATLSKEIRPVC HHEEECCCHHHHHHH | 24.72 | 25575281 | |
| 334 | Acetylation | LSRYQQFKDFQRRIL HHHHHHHHHHHHHHH | 53.98 | 72533263 | |
| 344 | Phosphorylation | QRRILVATNLFGRGM HHHHHHHHCCCCCCC | 25.60 | 23984901 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DX39B_RAT !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DX39B_RAT !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DX39B_RAT !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of DX39B_RAT !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...