DX39B_RAT - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: DX39B_RAT
• UniProt AC: Q63413
• Protein Name: Spliceosome RNA helicase Ddx39b
• Gene Name: Ddx39b
• Organism: Rattus norvegicus (Rat).
• Sequence Length: 428
• Subcellular Localization: Nucleus. Nucleus speckle. Cytoplasm. Can translocate to the cytoplasm in the presence of MX1..
• Protein Description: Involved in nuclear export of spliced and unspliced mRNA. Assembling component of the TREX complex which is thought to couple mRNA transcription, processing and nuclear export, and specifically associates with spliced mRNA and not with unspliced pre-mRNA. TREX is recruited to spliced mRNAs by a transcription-independent mechanism, binds to mRNA upstream of the exon-junction complex (EJC) and is recruited in a splicing- and cap-dependent manner to a region near the 5' end of the mRNA where it functions in mRNA export to the cytoplasm via the TAP/NFX1 pathway. May undergo several rounds of ATP hydrolysis during assembly of TREX to drive subsequent loading of components such as ALYREF/THOC and CHTOP onto mRNA. Also associates with pre-mRNA independent of ALYREF/THOC4 and the THO complex. Involved in the nuclear export of intronless mRNA; the ATP-bound form is proposed to recruit export adapter ALYREF/THOC4 to intronless mRNA; its ATPase activity is cooperatively stimulated by RNA and ALYREF/THOC4 and ATP hydrolysis is thought to trigger the dissociation from RNA to allow the association of ALYREF/THOC4 and the NXF1-NXT1 heterodimer. Involved in transcription elongation and genome stability (By similarity).; Splice factor that is required for the first ATP-dependent step in spliceosome assembly and for the interaction of U2 snRNP with the branchpoint. Has both RNA-stimulated ATP binding/hydrolysis activity and ATP-dependent RNA unwinding activity. Even with the stimulation of RNA, the ATPase activity is weak. Can only hydrolyze ATP but not other NTPs. The RNA stimulation of ATPase activity does not have a strong preference for the sequence and length of the RNA. However, ssRNA stimulates the ATPase activity much more strongly than dsRNA. Can unwind 5' or 3' overhangs or blunt end RNA duplexes in vitro. The ATPase and helicase activities are not influenced by U2AF2; the effect of ALYREF/THOC4 is reported conflictingly (By similarity)..
• Protein Sequence: MAENDVDNELLDYEDDEVETAAGADGTEAPAKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKFMQDPMEIFVDDETKLTLHGLQQYYVKLKDNEKNRKLFDLLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMPQEERLSRYQQFKDFQRRILVATNLFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISELPDEIDISSYIEQTR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MAENDVDNE ------CCCCCCCCC	25.05	-
13	Phosphorylation	VDNELLDYEDDEVET CCCCCCCCCCCCCCC	22.64	21373199
32	Acetylation	DGTEAPAKKDVKGSY CCCCCCCCCCCCCCE	48.74	22902405
36	Acetylation	APAKKDVKGSYVSIH CCCCCCCCCCEEEEE	52.88	72533283
38	Phosphorylation	AKKDVKGSYVSIHSS CCCCCCCCEEEEECC	19.35	27097102
39	Phosphorylation	KKDVKGSYVSIHSSG CCCCCCCEEEEECCC	13.59	25575281
41	Phosphorylation	DVKGSYVSIHSSGFR CCCCCEEEEECCCCH	13.32	23984901
44	Phosphorylation	GSYVSIHSSGFRDFL CCEEEEECCCCHHHH	30.41	23984901
45	Phosphorylation	SYVSIHSSGFRDFLL CEEEEECCCCHHHHC	27.99	23984901
53	Acetylation	GFRDFLLKPELLRAI CCHHHHCCHHHHHHH	38.30	72533285
156	Succinylation	FGGLSIKKDEEVLKK ECCCCCCCCHHHHHH	69.56	26843850
162	Acetylation	KKDEEVLKKNCPHIV CCCHHHHHHCCCEEE	47.30	22902405
172	Phosphorylation	CPHIVVGTPGRILAL CCEEEECCHHHHHHH	15.80	23984901
188	Acetylation	RNKSLNLKHIKHFIL CCCCCCHHHHHHHHH	42.06	22902405
218	Phosphorylation	VQEIFRMTPHEKQVM HHHHHHCCHHHHHHH	19.76	25575281
228	Phosphorylation	EKQVMMFSATLSKEI HHHHHHEEECCCHHH	11.49	25575281
230	Phosphorylation	QVMMFSATLSKEIRP HHHHEEECCCHHHHH	30.30	25575281
232	Phosphorylation	MMFSATLSKEIRPVC HHEEECCCHHHHHHH	24.72	25575281
334	Acetylation	LSRYQQFKDFQRRIL HHHHHHHHHHHHHHH	53.98	72533263
344	Phosphorylation	QRRILVATNLFGRGM HHHHHHHHCCCCCCC	25.60	23984901

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of DX39B_RAT !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of DX39B_RAT !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of DX39B_RAT !!

Protein-Protein Interaction

Oops, there are no PPI records of DX39B_RAT !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.