UniProt ID | ALDR_RAT | |
---|---|---|
UniProt AC | P07943 | |
Protein Name | Aldose reductase | |
Gene Name | Akr1b1 | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 316 | |
Subcellular Localization | Cytoplasm. | |
Protein Description | Catalyzes the NADPH-dependent reduction of a wide variety of carbonyl-containing compounds to their corresponding alcohols with a broad range of catalytic efficiencies.. | |
Protein Sequence | MASHLELNNGTKMPTLGLGTWKSPPGQVTEAVKVAIDMGYRHIDCAQVYQNEKEVGVALQEKLKEQVVKRQDLFIVSKLWCTFHDQSMVKGACQKTLSDLQLDYLDLYLIHWPTGFKPGPDYFPLDASGNVIPSDTDFVDTWTAMEQLVDEGLVKAIGVSNFNPLQIERILNKPGLKYKPAVNQIECHPYLTQEKLIEYCHCKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKEIAAKYNKTTAQVLIRFPIQRNLVVIPKSVTPARIAENFKVFDFELSNEDMATLLSYNRNWRVCALMSCAKHKDYPFHAEV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MASHLELNN ------CCCCEECCC | 12.98 | - | |
3 | Phosphorylation | -----MASHLELNNG -----CCCCEECCCC | 27.57 | 22673903 | |
12 | Acetylation | LELNNGTKMPTLGLG EECCCCCCCCCCCCC | 44.26 | 22902405 | |
22 | Acetylation | TLGLGTWKSPPGQVT CCCCCCCCCCCCCHH | 53.58 | 22902405 | |
23 | Phosphorylation | LGLGTWKSPPGQVTE CCCCCCCCCCCCHHH | 28.08 | 22108457 | |
53 | Acetylation | AQVYQNEKEVGVALQ HHHHCCHHHHHHHHH | 66.31 | 22902405 | |
64 | Acetylation | VALQEKLKEQVVKRQ HHHHHHHHHHHHHHH | 58.11 | 22902405 | |
69 | Acetylation | KLKEQVVKRQDLFIV HHHHHHHHHHCCEEE | 45.55 | 22902405 | |
95 | Acetylation | MVKGACQKTLSDLQL HHHHHHHHHHHHHCH | 51.85 | - | |
160 | Phosphorylation | LVKAIGVSNFNPLQI CHHHHCCCCCCHHHH | 30.41 | 22108457 | |
173 | Acetylation | QIERILNKPGLKYKP HHHHHHCCCCCCCCC | 36.70 | - | |
199 | Phosphorylation | TQEKLIEYCHCKGIV CHHHHHHHHCCCEEE | 4.78 | 14583551 | |
222 | Acetylation | SPDRPWAKPEDPSLL CCCCCCCCCCCCCHH | 45.10 | 22902405 | |
235 | Acetylation | LLEDPRIKEIAAKYN HHCCHHHHHHHHHCC | 44.33 | - | |
240 | Acetylation | RIKEIAAKYNKTTAQ HHHHHHHHCCCCCHH | 40.09 | 22902405 | |
263 | Acetylation | RNLVVIPKSVTPARI CCEEEECCCCCHHHH | 46.57 | 22902405 | |
264 | Phosphorylation | NLVVIPKSVTPARIA CEEEECCCCCHHHHH | 26.35 | 23984901 | |
266 | Phosphorylation | VVIPKSVTPARIAEN EEECCCCCHHHHHHC | 20.51 | 23984901 | |
308 | Acetylation | LMSCAKHKDYPFHAE HHHHHHCCCCCCCCC | 59.24 | 72588593 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ALDR_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ALDR_RAT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ALDR_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of ALDR_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...