UniProt ID | GDIB_RAT | |
---|---|---|
UniProt AC | P50399 | |
Protein Name | Rab GDP dissociation inhibitor beta | |
Gene Name | Gdi2 | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 445 | |
Subcellular Localization |
Cytoplasm. Membrane Peripheral membrane protein. |
|
Protein Description | Regulates the GDP/GTP exchange reaction of most Rab proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them.. | |
Protein Sequence | MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDQNPYYGGESASITPLEDLYKRFKLPGQPPASMGRGRDWNVDLIPKFLMANGQLVKMLLFTEVTRYMDFKVIEGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRFRKFLVYVANFDEKDPRTFEGVDPKKTSMRDVYKKFDLGQDVIDFTGHSLALYRTDDYLDQPCCETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIIVQNGKVVGVKSEGEIARCKQLICDPSYVKDRVEKVGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISFAHNVAAQGKYIAIVSTTVETKEPEKEIRPALELLEPIEQKFVSISDLFVPKDLGTDSQIFISRAYDATTHFETTCDDIKDIYKRMTGSEFDFEEMKRKKNDIYGED | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MNEEYDVI -------CCCCCCEE | 14.90 | - | |
57 | Succinylation | EDLYKRFKLPGQPPA HHHHHHCCCCCCCCC | 58.78 | - | |
57 | Succinylation | EDLYKRFKLPGQPPA HHHHHHCCCCCCCCC | 58.78 | - | |
99 | Phosphorylation | LFTEVTRYMDFKVIE HHHCHHHHCCEEEEE | 7.53 | - | |
112 | Acetylation | IEGSFVYKGGKIYKV EEEEEEEECCEEEEC | 56.75 | 22902405 | |
129 | Phosphorylation | TEAEALASSLMGLFE HHHHHHHHHHHHHHH | 25.51 | 22673903 | |
130 | Phosphorylation | EAEALASSLMGLFEK HHHHHHHHHHHHHHH | 19.44 | 22673903 | |
142 | Acetylation | FEKRRFRKFLVYVAN HHHHCHHHEEEEEEC | 40.10 | 22902405 | |
153 | Acetylation | YVANFDEKDPRTFEG EEECCCCCCCCCCCC | 74.91 | 26302492 | |
164 | Acetylation | TFEGVDPKKTSMRDV CCCCCCCCCCCHHHH | 65.31 | 22902405 | |
165 | Acetylation | FEGVDPKKTSMRDVY CCCCCCCCCCHHHHH | 51.74 | 26302492 | |
174 | Acetylation | SMRDVYKKFDLGQDV CHHHHHHHCCCCCCC | 26.82 | 22902405 | |
213 | Phosphorylation | INRIKLYSESLARYG HHHHHHHHHHHHHHC | 31.01 | - | |
221 | Acetylation | ESLARYGKSPYLYPL HHHHHHCCCCCEECC | 39.05 | 66734115 | |
221 | Ubiquitination | ESLARYGKSPYLYPL HHHHHHCCCCCEECC | 39.05 | - | |
224 | Phosphorylation | ARYGKSPYLYPLYGL HHHCCCCCEECCCCC | 26.42 | - | |
226 | Phosphorylation | YGKSPYLYPLYGLGE HCCCCCEECCCCCCC | 5.83 | - | |
229 | Phosphorylation | SPYLYPLYGLGELPQ CCCEECCCCCCCCCC | 13.05 | - | |
269 | Acetylation | NGKVVGVKSEGEIAR CCEEEEECCHHHHHH | 36.54 | 22902405 | |
360 | Ubiquitination | VSTTVETKEPEKEIR EEEEECCCCCHHHHH | 58.74 | - | |
382 | Phosphorylation | PIEQKFVSISDLFVP HHHHHCCCHHHCCCC | 21.36 | - | |
418 | Succinylation | ETTCDDIKDIYKRMT ECHHHHHHHHHHHHH | 45.10 | 26843850 | |
425 | Phosphorylation | KDIYKRMTGSEFDFE HHHHHHHHCCCCCHH | 41.40 | 25575281 | |
427 | Phosphorylation | IYKRMTGSEFDFEEM HHHHHHCCCCCHHHH | 26.39 | 28432305 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GDIB_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GDIB_RAT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GDIB_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of GDIB_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...