| UniProt ID | RAS1_DROME | |
|---|---|---|
| UniProt AC | P08646 | |
| Protein Name | Ras-like protein 1 | |
| Gene Name | Ras85D | |
| Organism | Drosophila melanogaster (Fruit fly). | |
| Sequence Length | 189 | |
| Subcellular Localization |
Cell membrane Lipid-anchor Cytoplasmic side . Loss of prenylation causes protein location to the cytoplasm. |
|
| Protein Description | Ras proteins bind GDP/GTP and possess intrinsic GTPase activity (By similarity). Plays a role in eye development by regulating cell growth, survival of postmitotic ommatidial cells and differentiation of photoreceptor cells. [PubMed: 11290305 During larval development, mediates Ptth/tor signaling leading to the production of ecdysone, a hormone required for the initiation of metamorphosis] | |
| Protein Sequence | MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLLVFAVNSAKSFEDIGTYREQIKRVKDAEEVPMVLVGNKCDLASWNVNNEQAREVAKQYGIPYIETSAKTRMGVDDAFYTLVREIRKDKDNKGRRGRKMNKPNRRFKCKML | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 186 | Methylation | KPNRRFKCKML---- CCCCCCCCCCC---- | 2.62 | - | |
| 186 | Geranylgeranylation | KPNRRFKCKML---- CCCCCCCCCCC---- | 2.62 | 18503409 | |
| 186 | Geranylgeranylation | KPNRRFKCKML---- CCCCCCCCCCC---- | 2.62 | 18503409 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RAS1_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RAS1_DROME !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RAS1_DROME !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
