UniProt ID | SPITZ_DROME | |
---|---|---|
UniProt AC | Q01083 | |
Protein Name | Protein spitz | |
Gene Name | spi | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 234 | |
Subcellular Localization |
Cell membrane Single-pass type I membrane protein . Endoplasmic reticulum membrane Single-pass type I membrane protein . Golgi apparatus membrane Single-pass type I membrane protein . Relocalization to the Golgi apparatus and the plasma membran |
|
Protein Description | Ligand for the EGF receptor (Gurken). Involved in a number of unrelated developmental choices, for example, dorsal-ventral axis formation, glial migration, sensory organ determination, and muscle development. It is required for photoreceptor determination.. | |
Protein Sequence | MHSTMSVQHGLVALVLIGCLAHPWHVEACSSRTVPKPRSSISSSMSGTALPPTQAPVTSSTTMRTTTTTTPRPNITFPTYKCPETFDAWYCLNDAHCFAVKIADLPVYSCECAIGFMGQRCEYKEIDNTYLPKRPRPMLEKASIASGAMCALVFMLFVCLAFYLRFEQRAAKKAYELEQELQQEYDDDDGQCECCRNRCCPDGQEPVILERKLPYHMRLEHALMSFAIRRSNKL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SPITZ_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SPITZ_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SPITZ_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TNKS_DROME | Tnks | physical | 15710747 | |
ABRU_DROME | ab | physical | 15710747 | |
GALT6_DROME | pgant6 | physical | 15710747 | |
GGNB2_DROME | CG2182 | physical | 15710747 | |
FSH_DROME | fs(1)h | physical | 15710747 | |
GSTS1_DROME | GstS1 | physical | 15710747 | |
HNF4_DROME | Hnf4 | physical | 15710747 | |
NETB_DROME | NetB | physical | 15710747 | |
OVO_DROME | ovo | genetic | 10421370 | |
DECA_DROME | dpp | genetic | 10934021 | |
SALM_DROME | salm | genetic | 11171397 | |
VG_DROME | vg | genetic | 9927598 | |
EGFR_DROME | Egfr | genetic | 8929534 | |
RHOM_DROME | rho | genetic | 10570464 | |
SPY_DROME | sty | genetic | 10089881 | |
VEIN_DROME | vn | genetic | 8824589 | |
VEIN_DROME | vn | genetic | 25336739 | |
HID_DROME | W | genetic | 11832242 | |
EGFR_DROME | Egfr | physical | 16459296 | |
GIL_DROME | aos | physical | 16459296 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...