SPITZ_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SPITZ_DROME
• UniProt AC: Q01083
• Protein Name: Protein spitz
• Gene Name: spi
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 234
• Subcellular Localization: Cell membrane ; Single-pass type I membrane protein . Endoplasmic reticulum membrane ; Single-pass type I membrane protein . Golgi apparatus membrane ; Single-pass type I membrane protein . Relocalization to the Golgi apparatus and the plasma membran
• Protein Description: Ligand for the EGF receptor (Gurken). Involved in a number of unrelated developmental choices, for example, dorsal-ventral axis formation, glial migration, sensory organ determination, and muscle development. It is required for photoreceptor determination..
• Protein Sequence: MHSTMSVQHGLVALVLIGCLAHPWHVEACSSRTVPKPRSSISSSMSGTALPPTQAPVTSSTTMRTTTTTTPRPNITFPTYKCPETFDAWYCLNDAHCFAVKIADLPVYSCECAIGFMGQRCEYKEIDNTYLPKRPRPMLEKASIASGAMCALVFMLFVCLAFYLRFEQRAAKKAYELEQELQQEYDDDDGQCECCRNRCCPDGQEPVILERKLPYHMRLEHALMSFAIRRSNKL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
29	S-palmitoylation	HPWHVEACSSRTVPK CCHHHHHHCCCCCCC	2.10	16459296
74	N-linked_Glycosylation	TTTTPRPNITFPTYK CCCCCCCCCCCCCCC	47.41	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SPITZ_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SPITZ_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SPITZ_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TNKS_DROME	Tnks	physical	15710747
ABRU_DROME	ab	physical	15710747
GALT6_DROME	pgant6	physical	15710747
GGNB2_DROME	CG2182	physical	15710747
FSH_DROME	fs(1)h	physical	15710747
GSTS1_DROME	GstS1	physical	15710747
HNF4_DROME	Hnf4	physical	15710747
NETB_DROME	NetB	physical	15710747
OVO_DROME	ovo	genetic	10421370
DECA_DROME	dpp	genetic	10934021
SALM_DROME	salm	genetic	11171397
VG_DROME	vg	genetic	9927598
EGFR_DROME	Egfr	genetic	8929534
RHOM_DROME	rho	genetic	10570464
SPY_DROME	sty	genetic	10089881
VEIN_DROME	vn	genetic	8824589
VEIN_DROME	vn	genetic	25336739
HID_DROME	W	genetic	11832242
EGFR_DROME	Egfr	physical	16459296
GIL_DROME	aos	physical	16459296

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.