GALT6_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: GALT6_DROME
• UniProt AC: Q6WV16
• Protein Name: N-acetylgalactosaminyltransferase 6
• Gene Name: pgant6
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 666
• Subcellular Localization: Golgi apparatus membrane; Single-pass type II membrane protein.
• Protein Description: Glycopeptide transferase involved in O-linked oligosaccharide biosynthesis, which catalyzes the transfer of an N-acetyl-D-galactosamine residue to an already glycosylated peptide. In contrast to other proteins of the family, it does not act as a peptide transferase that transfers GalNAc onto serine or threonine residue on the protein receptor, but instead requires the prior addition of a GalNAc on a peptide before adding additional GalNAc moieties. Some peptide transferase activity is however not excluded, considering that its appropriate peptide substrate may remain unidentified. Prefers the diglycosylated Muc5AC-3/13 as substrate..
• Protein Sequence: MRRPNLKWIVKASLLLLISLTLFVLITSWISSTPYTNKPVHHGVEPVPEKAGLSGDVKVKVPAIKQPEPQKPQEPDFEEDPELQKIDEPEPVEEEVDNPHPADDEPQQQPQEELQMAAPADASVKKDWHDYTFMEKDAKRVGLGEGGKASTLDDESQRDLEKRMSLENGFNALLSDSISVNRSVPDIRHPLCRKKEYVAKLPTVSVIIIFYNEYLSVLMRSVHSLINRSPPELMKEIILVDDHSDREYLGKELETYIAEHFKWVRVVRLPRRTGLIGARAAGARNATAEVLIFLDSHVEANYNWLPPLLEPIALNKRTAVCPFIDVIDHTNFHYRAQDEGARGAFDWEFFYKRLPLLPEDLKHPADPFKSPIMAGGLFAISREFFWELGGYDEGLDIWGGEQYELSFKIWMCGGEMYDAPCSRIGHIYRGPRNHQPSPRKGDYLHKNYKRVAEVWMDEYKNYLYSHGDGLYESVDPGDLTEQKAIRTKLNCKSFKWFMEEVAFDLMKTYPPVDPPSYAMGALQNVGNQNLCLDTLGRKKHNKMGMYACADNIKTPQRTQFWELSWKRDLRLRRKKECLDVQIWDANAPVWLWDCHSQGGNQYWYYDYRHKQLKHGTEGRRCLELLPFSQEVVANKCDTDNRFQQWNFGSFNKTALDNYSQDLVLSL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
181	N-linked_Glycosylation	LSDSISVNRSVPDIR HCCCCCCCCCCCCCC	24.58	-
285	N-linked_Glycosylation	ARAAGARNATAEVLI HHHHCCCCCCEEEEE	40.90	-
651	N-linked_Glycosylation	QWNFGSFNKTALDNY HCCCCCCCCHHHHHC	42.33	-
657	N-linked_Glycosylation	FNKTALDNYSQDLVL CCCHHHHHCCCCHHH	38.92	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of GALT6_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of GALT6_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of GALT6_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.