dbPTM

GSTS1_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	GSTS1_DROME
UniProt AC	P41043
Protein Name	Glutathione S-transferase S1 {ECO:0000303\|PubMed:12547198, ECO:0000303\|PubMed:22082028}
Gene Name	GstS1 {ECO:0000312\|FlyBase:FBgn0010226}
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	249
Subcellular Localization
Protein Description	Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. [PubMed: 22082028 May be involved in the detoxification of metabolites produced during cellular division and morphogenesis]
Protein Sequence	MADEAQAPPAEGAPPAEGEAPPPAEGAEGAVEGGEAAPPAEPAEPIKHSYTLFYFNVKALAEPLRYLFAYGNQEYEDVRVTRDEWPALKPTMPMGQMPVLEVDGKRVHQSISMARFLAKTVGLCGATPWEDLQIDIVVDTINDFRLKIAVVSYEPEDEIKEKKLVTLNAEVIPFYLEKLEQTVKDNDGHLALGKLTWADVYFAGITDYMNYMVKRDLLEPYPALRGVVDAVNALEPIKAWIEKRPVTEV

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of GSTS1_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of GSTS1_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of GSTS1_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of GSTS1_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MYSA_DROME	Mhc	physical	22036573
COX5A_DROME	CoVa	physical	22036573
CISY_DROME	kdn	physical	22036573
TPM1_DROME	Tm1	physical	16752200
TPM4_DROME	Tm1	physical	16752200
TPM1_DROME	Tm1	physical	9536439
TPM4_DROME	Tm1	physical	9536439

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of GSTS1_DROME

Related Literatures of Post-Translational Modification