UniProt ID | COX5A_DROME | |
---|---|---|
UniProt AC | Q94514 | |
Protein Name | Cytochrome c oxidase subunit 5A, mitochondrial | |
Gene Name | COX5A {ECO:0000312|FlyBase:FBgn0019624} | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 149 | |
Subcellular Localization | Mitochondrion inner membrane. | |
Protein Description | This is the heme A-containing chain of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.. | |
Protein Sequence | MLSITARNLASALRSSLVGTSSRVAAVRCLHGTEESAEEFDKRYEKYFSREGIDGWEIRKGMNDLLGMDLVPSPKIIEAGLRASRRVNDIALAIRWLEGCKDKCGDQKATLYPYLLEKITPTLQELGIPTIEELGYDKPELALKSVYDA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
46 | Acetylation | EFDKRYEKYFSREGI HHHHHHHHHHHCCCC | 42.53 | 21791702 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of COX5A_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of COX5A_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of COX5A_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RS28_DROME | RpS28b | physical | 14605208 | |
ACT1_DROME | Act5C | physical | 14605208 | |
RLA1_DROME | RpLP1 | physical | 14605208 | |
RL9_DROME | RpL9 | physical | 14605208 | |
ATPK_DROME | CG4692 | physical | 22036573 | |
CUL1_DROME | Cul1 | genetic | 20176921 | |
FBXW7_DROME | ago | genetic | 20176921 | |
PSB1_DROME | Prosbeta6 | genetic | 20176921 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...