UniProt ID | ATPK_DROME | |
---|---|---|
UniProt AC | Q9W141 | |
Protein Name | Putative ATP synthase subunit f, mitochondrial | |
Gene Name | CG4692 | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 107 | |
Subcellular Localization | Mitochondrion membrane. | |
Protein Description | Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. Minor subunit located with subunit a in the membrane (By similarity).. | |
Protein Sequence | MAFGDYPAEYNPKVHGPYDPARFYGKADVPFGQVKLGEIGAWLGRRNKTPNAVAGAVSRAWWRWQHKYVFPKRAGIAPFFQLTVASMTFFYLINYTKLKHHRNYKYH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
13 | Acetylation | YPAEYNPKVHGPYDP CCCCCCCCCCCCCCH | 43.13 | 21791702 | |
26 | Acetylation | DPARFYGKADVPFGQ CHHHHCCCCCCCCCE | 29.99 | 21791702 | |
49 | Phosphorylation | WLGRRNKTPNAVAGA HHCCCCCCCCHHHHH | 25.89 | 22668510 | |
67 | Ubiquitination | AWWRWQHKYVFPKRA HHHHHHCCCCCCCCC | 28.19 | 31113955 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ATPK_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ATPK_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ATPK_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
KRI1_DROME | CG5645 | physical | 14605208 | |
MYSA_DROME | Mhc | physical | 22036573 | |
ATPB_DROME | ATPsyn-beta | physical | 25023514 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...