UniProt ID | RLA1_DROME | |
---|---|---|
UniProt AC | P08570 | |
Protein Name | 60S acidic ribosomal protein P1 | |
Gene Name | RpLP1 | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 112 | |
Subcellular Localization | ||
Protein Description | Plays an important role in the elongation step of protein synthesis.. | |
Protein Sequence | MSTKAELACVYASLILVDDDVAVTGEKINTILKAANVEVEPYWPGLFAKALEGINVKDLITNIGSGVGAAPAGGAAPAAAAAAPAAESKKEEKKKEEESDQSDDDMGFGLFD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
65 | Phosphorylation | DLITNIGSGVGAAPA HHHHHCCCCCCCCCC | 26.89 | 22817900 | |
88 | Phosphorylation | AAAPAAESKKEEKKK HHCHHHHHHHHHHHH | 44.28 | 22817900 | |
99 | Phosphorylation | EKKKEEESDQSDDDM HHHHHHHCCCCCCCC | 44.20 | 21082442 | |
102 | Phosphorylation | KEEESDQSDDDMGFG HHHHCCCCCCCCCCC | 48.25 | 21082442 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RLA1_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RLA1_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RLA1_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RLA0_DROME | RpLP0 | physical | 14605208 | |
DEI_DROME | tx | physical | 14605208 | |
ESM7_DROME | E(spl)m7-HLH | physical | 14605208 | |
TCPG_DROME | Cctgamma | physical | 14605208 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Phosphoproteome analysis of Drosophila melanogaster embryos."; Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P.; J. Proteome Res. 7:1675-1682(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-99 AND SER-102, AND MASSSPECTROMETRY. |