UniProt ID | ESM7_DROME | |
---|---|---|
UniProt AC | P13097 | |
Protein Name | Enhancer of split m7 protein | |
Gene Name | E(spl)m7-HLH {ECO:0000312|FlyBase:FBgn0002633} | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 186 | |
Subcellular Localization | Nucleus . | |
Protein Description | Participates in the control of cell fate choice by uncommitted neuroectodermal cells in the embryo. Transcriptional repressor. Binds DNA on N-box motifs: 5'-CACNAG-3'.. | |
Protein Sequence | MATKYEMSKTYQYRKVMKPLLERKRRARINKCLDELKDLMAECVAQTGDAKFEKADILEVTVQHLRKLKESKKHVPANPEQSFRAGYIRAANEVSRALASLPRVDVAFGTTLMTHLGMRLNQLEQPMEQPQAVNTPLSIVCGSSSSSSTYSSASSCSSISPVSSGYASDNESLLQISSPGQVWRPW | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of ESM7_DROME !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ESM7_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ESM7_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ESM7_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
AST5_DROME | ac | physical | 9371806 | |
AST4_DROME | sc | physical | 9371806 | |
AST8_DROME | ase | physical | 9371806 | |
DA_DROME | da | physical | 9371806 | |
ATO_DROME | ato | physical | 9371806 | |
ESMD_DROME | E(spl)mdelta-HLH | physical | 9371806 | |
ESMC_DROME | E(spl)mgamma-HLH | physical | 9371806 | |
ESMB_DROME | E(spl)mbeta-HLH | physical | 9371806 | |
ESM5_DROME | E(spl)m5-HLH | physical | 9371806 | |
ESM8_DROME | E(spl)m8-HLH | physical | 9371806 | |
GROU_DROME | gro | physical | 16762837 | |
GROU_DROME | gro | physical | 8001118 | |
GROU_DROME | gro | physical | 8649374 | |
GROU_DROME | gro | physical | 9751710 | |
GROU_DROME | gro | physical | 10433905 | |
GROU_DROME | gro | physical | 17571073 | |
GROU_DROME | gro | physical | 9371806 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...