| UniProt ID | ESM5_DROME | |
|---|---|---|
| UniProt AC | P13096 | |
| Protein Name | Enhancer of split m5 protein | |
| Gene Name | E(spl)m5-HLH {ECO:0000312|FlyBase:FBgn0002631} | |
| Organism | Drosophila melanogaster (Fruit fly). | |
| Sequence Length | 178 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Participates in the control of cell fate choice by uncommitted neuroectodermal cells in the embryo. Transcriptional repressor. Binds DNA on N-box motifs: 5'-CACNAG-3'.. | |
| Protein Sequence | MAPQSNNSTTFVSKTQHYLKVKKPLLERQRRARMNKCLDTLKTLVAEFQGDDAILRMDKAEMLEAALVFMRKQVVKQQAPVSPLPMDSFKNGYMNAVSEISRVMACTPAMSVDVGKTVMTHLGVEFQRMLQADQVQTSVTTSTPRPLSPASSGYHSDNEDSQSAASPKPVEETMWRPW | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of ESM5_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ESM5_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ESM5_DROME !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ESM5_DROME !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| EGON_DROME | eg | physical | 14605208 | |
| TAP_DROME | tap | physical | 14605208 | |
| GROU_DROME | gro | physical | 14605208 | |
| DA_DROME | da | physical | 9371806 | |
| ESMD_DROME | E(spl)mdelta-HLH | physical | 9371806 | |
| ESMC_DROME | E(spl)mgamma-HLH | physical | 9371806 | |
| ESMB_DROME | E(spl)mbeta-HLH | physical | 9371806 | |
| ESM5_DROME | E(spl)m5-HLH | physical | 9371806 | |
| ESM8_DROME | E(spl)m8-HLH | physical | 9371806 | |
| GROU_DROME | gro | physical | 16762837 | |
| GROU_DROME | gro | physical | 8001118 | |
| GROU_DROME | gro | physical | 9371806 | |
| GROU_DROME | gro | physical | 9524128 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...