ESM5_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ESM5_DROME
• UniProt AC: P13096
• Protein Name: Enhancer of split m5 protein
• Gene Name: E(spl)m5-HLH {ECO:0000312|FlyBase:FBgn0002631}
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 178
• Subcellular Localization: Nucleus .
• Protein Description: Participates in the control of cell fate choice by uncommitted neuroectodermal cells in the embryo. Transcriptional repressor. Binds DNA on N-box motifs: 5'-CACNAG-3'..
• Protein Sequence: MAPQSNNSTTFVSKTQHYLKVKKPLLERQRRARMNKCLDTLKTLVAEFQGDDAILRMDKAEMLEAALVFMRKQVVKQQAPVSPLPMDSFKNGYMNAVSEISRVMACTPAMSVDVGKTVMTHLGVEFQRMLQADQVQTSVTTSTPRPLSPASSGYHSDNEDSQSAASPKPVEETMWRPW

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of ESM5_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ESM5_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ESM5_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ESM5_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
EGON_DROME	eg	physical	14605208
TAP_DROME	tap	physical	14605208
GROU_DROME	gro	physical	14605208
DA_DROME	da	physical	9371806
ESMD_DROME	E(spl)mdelta-HLH	physical	9371806
ESMC_DROME	E(spl)mgamma-HLH	physical	9371806
ESMB_DROME	E(spl)mbeta-HLH	physical	9371806
ESM5_DROME	E(spl)m5-HLH	physical	9371806
ESM8_DROME	E(spl)m8-HLH	physical	9371806
GROU_DROME	gro	physical	16762837
GROU_DROME	gro	physical	8001118
GROU_DROME	gro	physical	9371806
GROU_DROME	gro	physical	9524128

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.