UniProt ID | ESM8_DROME | |
---|---|---|
UniProt AC | P13098 | |
Protein Name | Enhancer of split m8 protein | |
Gene Name | E(spl) | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 179 | |
Subcellular Localization | Nucleus . | |
Protein Description | Participates in the control of cell fate choice by uncommitted neuroectodermal cells in the embryo. [PubMed: 2540957 Transcriptional repressor] | |
Protein Sequence | MEYTTKTQIYQKVKKPMLERQRRARMNKCLDNLKTLVAELRGDDGILRMDKAEMLESAVIFMRQQKTPKKVAQEEQSLPLDSFKNGYMNAVNEVSRVMASTPGMSVDLGKSVMTHLGRVYKNLQQFHEAQSAADFIQNSMDCSSMDKAPLSPASSGYHSDCDSPAPSPQPMQQPLWRPW | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
159 | Phosphorylation | PASSGYHSDCDSPAP CCCCCCCCCCCCCCC | 31.30 | 15003630 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
159 | S | Phosphorylation | Kinase | CK2-FAMILY | - | GPS |
159 | S | Phosphorylation | Kinase | CKII_GROUP | - | PhosphoELM |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ESM8_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ESM8_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
GROU_DROME | gro | physical | 14605208 | |
FBP2_DROME | Fbp2 | physical | 22036573 | |
TBB2_DROME | betaTub85D | physical | 22036573 | |
RS15B_DROME | RpS15Ab | physical | 22036573 | |
ATO_DROME | ato | genetic | 19415625 | |
CSK2A_DROME | CkIIalpha | genetic | 19415625 | |
WASC3_DROME | CG7429 | physical | 25242320 | |
DA_DROME | da | physical | 9371806 | |
DPN_DROME | dpn | physical | 22357926 | |
HAIR_DROME | h | physical | 14871887 | |
ATO_DROME | ato | physical | 21789514 | |
ESMD_DROME | E(spl)mdelta-HLH | physical | 9371806 | |
ESMC_DROME | E(spl)mgamma-HLH | physical | 9371806 | |
ESMB_DROME | E(spl)mbeta-HLH | physical | 9371806 | |
ESM5_DROME | E(spl)m5-HLH | physical | 9371806 | |
ESM8_DROME | E(spl)m8-HLH | physical | 21789514 | |
ESM8_DROME | E(spl)m8-HLH | physical | 9371806 | |
GROU_DROME | gro | physical | 16762837 | |
GROU_DROME | gro | physical | 8001118 | |
GROU_DROME | gro | physical | 21789514 | |
GROU_DROME | gro | physical | 9371806 | |
GROU_DROME | gro | physical | 9524128 | |
CSK2A_DROME | CkIIalpha | physical | 21789514 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...