ESM8_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ESM8_DROME
• UniProt AC: P13098
• Protein Name: Enhancer of split m8 protein
• Gene Name: E(spl)
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 179
• Subcellular Localization: Nucleus .
• Protein Description: Participates in the control of cell fate choice by uncommitted neuroectodermal cells in the embryo. [PubMed: 2540957 Transcriptional repressor]
• Protein Sequence: MEYTTKTQIYQKVKKPMLERQRRARMNKCLDNLKTLVAELRGDDGILRMDKAEMLESAVIFMRQQKTPKKVAQEEQSLPLDSFKNGYMNAVNEVSRVMASTPGMSVDLGKSVMTHLGRVYKNLQQFHEAQSAADFIQNSMDCSSMDKAPLSPASSGYHSDCDSPAPSPQPMQQPLWRPW

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
159	Phosphorylation	PASSGYHSDCDSPAP CCCCCCCCCCCCCCC	31.30	15003630

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
159	S	Phosphorylation	Kinase	CK2-FAMILY	-	GPS
159	S	Phosphorylation	Kinase	CKII_GROUP	-	PhosphoELM

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ESM8_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ESM8_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
GROU_DROME	gro	physical	14605208
FBP2_DROME	Fbp2	physical	22036573
TBB2_DROME	betaTub85D	physical	22036573
RS15B_DROME	RpS15Ab	physical	22036573
ATO_DROME	ato	genetic	19415625
CSK2A_DROME	CkIIalpha	genetic	19415625
WASC3_DROME	CG7429	physical	25242320
DA_DROME	da	physical	9371806
DPN_DROME	dpn	physical	22357926
HAIR_DROME	h	physical	14871887
ATO_DROME	ato	physical	21789514
ESMD_DROME	E(spl)mdelta-HLH	physical	9371806
ESMC_DROME	E(spl)mgamma-HLH	physical	9371806
ESMB_DROME	E(spl)mbeta-HLH	physical	9371806
ESM5_DROME	E(spl)m5-HLH	physical	9371806
ESM8_DROME	E(spl)m8-HLH	physical	21789514
ESM8_DROME	E(spl)m8-HLH	physical	9371806
GROU_DROME	gro	physical	16762837
GROU_DROME	gro	physical	8001118
GROU_DROME	gro	physical	21789514
GROU_DROME	gro	physical	9371806
GROU_DROME	gro	physical	9524128
CSK2A_DROME	CkIIalpha	physical	21789514

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.