TBB2_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TBB2_DROME
• UniProt AC: P61857
• Protein Name: Tubulin beta-2 chain
• Gene Name: betaTub85D
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 446
• Subcellular Localization: Cytoplasm, cytoskeleton.
• Protein Description: Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha chain..
• Protein Sequence: MREIVHIQAGQCGNQIGGKFWEVISDEHCIDATGTYYGDSDLQLERINVYYNEATGAKYVPRAILVDLEPGTMDSVRSGAFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESEGCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNIQNKNSSFFVEWIPNNCKTAVCDIPPRGLKMSATFIGNSTAIQELFKRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQEATADEEGEFDEDEEGGGDE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
115	Phosphorylation	EGAELVDSVLDVVRK CHHHHHHHHHHHHHH	19.66	22817900
274	Phosphorylation	MPGFAPLTSRGSQQY CCCCCCCCCCCCHHH	18.47	19429919
275	Phosphorylation	PGFAPLTSRGSQQYR CCCCCCCCCCCHHHE	42.18	19429919
278	Phosphorylation	APLTSRGSQQYRALT CCCCCCCCHHHEEEE	17.01	19429919
281	Phosphorylation	TSRGSQQYRALTVPE CCCCCHHHEEEEHHH	7.10	19429919
312	Phosphorylation	PRHGRYLTVAAIFRG CCCCCCHHHHHHHCC	10.12	21082442
322	Phosphorylation	AIFRGRMSMKEVDEQ HHHCCCCCHHHHHHH	25.91	21082442
366	Phosphorylation	RGLKMSATFIGNSTA CCCEEEEEECCCHHH	14.42	21082442

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TBB2_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TBB2_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TBB2_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RS15B_DROME	RpS15Ab	physical	22036573
ATPB_DROME	ATPsyn-beta	physical	22036573
ARF1_DROME	Arf79F	physical	22036573

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.