UniProt ID | TBB2_DROME | |
---|---|---|
UniProt AC | P61857 | |
Protein Name | Tubulin beta-2 chain | |
Gene Name | betaTub85D | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 446 | |
Subcellular Localization | Cytoplasm, cytoskeleton. | |
Protein Description | Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha chain.. | |
Protein Sequence | MREIVHIQAGQCGNQIGGKFWEVISDEHCIDATGTYYGDSDLQLERINVYYNEATGAKYVPRAILVDLEPGTMDSVRSGAFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESEGCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNIQNKNSSFFVEWIPNNCKTAVCDIPPRGLKMSATFIGNSTAIQELFKRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQEATADEEGEFDEDEEGGGDE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
115 | Phosphorylation | EGAELVDSVLDVVRK CHHHHHHHHHHHHHH | 19.66 | 22817900 | |
274 | Phosphorylation | MPGFAPLTSRGSQQY CCCCCCCCCCCCHHH | 18.47 | 19429919 | |
275 | Phosphorylation | PGFAPLTSRGSQQYR CCCCCCCCCCCHHHE | 42.18 | 19429919 | |
278 | Phosphorylation | APLTSRGSQQYRALT CCCCCCCCHHHEEEE | 17.01 | 19429919 | |
281 | Phosphorylation | TSRGSQQYRALTVPE CCCCCHHHEEEEHHH | 7.10 | 19429919 | |
312 | Phosphorylation | PRHGRYLTVAAIFRG CCCCCCHHHHHHHCC | 10.12 | 21082442 | |
322 | Phosphorylation | AIFRGRMSMKEVDEQ HHHCCCCCHHHHHHH | 25.91 | 21082442 | |
366 | Phosphorylation | RGLKMSATFIGNSTA CCCEEEEEECCCHHH | 14.42 | 21082442 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TBB2_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TBB2_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TBB2_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RS15B_DROME | RpS15Ab | physical | 22036573 | |
ATPB_DROME | ATPsyn-beta | physical | 22036573 | |
ARF1_DROME | Arf79F | physical | 22036573 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...