UniProt ID | ARF1_DROME | |
---|---|---|
UniProt AC | P61209 | |
Protein Name | ADP-ribosylation factor 1 | |
Gene Name | Arf79F | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 182 | |
Subcellular Localization | Golgi apparatus . Cytoplasm, cytosol . Localization to the Golgi is dependent on Asap. | |
Protein Description | GTP-binding protein involved in protein trafficking; has a role in Golgi organization and may modulate vesicle budding and uncoating within the Golgi apparatus (Probable). Has a role in eye development. [PubMed: 21976699 Required for cleavage furrow ingression in embryonic cells] | |
Protein Sequence | MGNVFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIGEAREELMRMLAEDELRDAVLLIFANKQDLPNAMNAAEITDKLGLHSLRNRNWYIQATCATSGDGLYEGLDWLSNQLKNANR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ARF1_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ARF1_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ARF1_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ROA1_DROME | Hrb98DE | physical | 14605208 | |
DX39B_DROME | Hel25E | physical | 22036573 | |
ACADM_DROME | CG12262 | physical | 22036573 | |
TCPG_DROME | Cctgamma | physical | 22036573 | |
ERD2_DROME | KdelR | physical | 22036573 | |
CATL_DROME | Cp1 | physical | 22036573 | |
ARF2_DROME | Arf102F | physical | 22036573 | |
QCR9_DROME | ox | physical | 22036573 | |
ARL8_DROME | Gie | physical | 22036573 | |
GALE_DROME | Gale | physical | 22036573 | |
OST48_DROME | Ost48 | physical | 22036573 | |
RS15B_DROME | RpS15Ab | physical | 22036573 | |
RAB6_DROME | Rab6 | physical | 22036573 | |
COPB_DROME | betaCOP | physical | 22291037 | |
OCAD1_DROME | asrij | physical | 24707047 | |
HEM_DROME | Hem | physical | 22992458 | |
CYFIP_DROME | Sra-1 | physical | 22992458 | |
COPG_DROME | gammaCOP | physical | 22291037 | |
AP3D_DROME | g | physical | 22291037 | |
COPB2_DROME | betaCOP | physical | 22291037 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...