UniProt ID | ARF2_DROME | |
---|---|---|
UniProt AC | P40945 | |
Protein Name | ADP-ribosylation factor 2 | |
Gene Name | Arf102F | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 180 | |
Subcellular Localization | Golgi apparatus. | |
Protein Description | GTP-binding protein involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus.. | |
Protein Sequence | MGLTISSLLTRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRITEAERELQNMLQEDELRDAVLLVFANKQDLPNAMTAAELTDKLRLNQLRNRHWFIQSTCATQGHGLYEGLDWLSAELAKK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Myristoylation | ------MGLTISSLL ------CCCCHHHHH | 31.37 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ARF2_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ARF2_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ARF2_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ACADM_DROME | CG12262 | physical | 22036573 | |
ERD2_DROME | KdelR | physical | 22036573 | |
MSS4_DROME | CG7787 | physical | 22036573 | |
ARL8_DROME | Gie | physical | 22036573 | |
KRH2_DROME | Kr-h2 | physical | 22036573 | |
COPB_DROME | betaCOP | physical | 22291037 | |
COPG_DROME | gammaCOP | physical | 22291037 | |
AP3D_DROME | g | physical | 22291037 | |
COPB2_DROME | betaCOP | physical | 22291037 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...