| UniProt ID | ROA1_DROME | |
|---|---|---|
| UniProt AC | P07909 | |
| Protein Name | Heterogeneous nuclear ribonucleoprotein A1 | |
| Gene Name | Hrb98DE | |
| Organism | Drosophila melanogaster (Fruit fly). | |
| Sequence Length | 365 | |
| Subcellular Localization | Nucleus. | |
| Protein Description | This protein is a component of ribonucleosomes.. | |
| Protein Sequence | MVNSNQNQNGNSNGHDDDFPQDSITEPEHMRKLFIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEAQKSRPHKIDGRVVEPKRAVPRQDIDSPNAGATVKKLFVGALKDDHDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVLQKQHQLNGKMVDVKKALPKQNDQQGGGGGRGGPGGRAGGNRGNMGGGNYGNQNGGGNWNNGGNNWGNNRGGNDNWGNNSFGGGGGGGGGYGGGNNSWGNNNPWDNGNGGGNFGGGGNNWNNGGNDFGGYQQNYGGGPQRGGGNFNNNRMQPYQGGGGFKAGGGNQGNYGGNNQGFNNGGNNRRY | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 4 | Phosphorylation | ----MVNSNQNQNGN ----CCCCCCCCCCC | 28.51 | - | |
| 4 (in isoform 4) | Phosphorylation | - | 28.51 | 19429919 | |
| 12 (in isoform 4) | Phosphorylation | - | 45.66 | 19429919 | |
| 19 (in isoform 4) | Phosphorylation | - | 8.23 | 19429919 | |
| 21 (in isoform 4) | Phosphorylation | - | 58.01 | 22668510 | |
| 23 | Phosphorylation | DDDFPQDSITEPEHM CCCCCCCCCCCHHHH | 26.60 | 22668510 | |
| 83 | Phosphorylation | FITYSHSSMIDEAQK EEEECCHHHCCHHHH | 17.84 | 22668510 | |
| 114 | Phosphorylation | VPRQDIDSPNAGATV CCCCCCCCCCCCHHH | 22.01 | 19429919 | |
| 190 | Acetylation | KQHQLNGKMVDVKKA EEHHHCCEECCHHHH | 34.38 | 21791702 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ROA1_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ROA1_DROME !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ROA1_DROME !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| RB87F_DROME | Hrb87F | physical | 22036573 | |
| PGPLB_DROME | PGRP-LB | physical | 22036573 | |
| PARG_DROME | Parg | genetic | 22453833 | |
| CADE_DROME | shg | genetic | 22453833 | |
| PELO_DROME | pelo | physical | 27402862 | |
| CADE_DROME | shg | physical | 27402862 | |
| PUM_DROME | pum | physical | 27402862 | |
| NANOS_DROME | nos | physical | 27402862 | |
| HOW_DROME | how | physical | 27402862 | |
| FKBP6_DROME | shu | physical | 27402862 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
