PGPLB_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PGPLB_DROME
• UniProt AC: Q8INK6
• Protein Name: Peptidoglycan-recognition protein LB
• Gene Name: PGRP-LB
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 232
• Subcellular Localization: Isoform C: Secreted .
• Protein Description: N-acetylmuramyl-L-alanine amidase involved in innate immunity by degrading bacterial peptidoglycans (PGN). Probably plays a scavenger role by digesting biologically active PGN into biologically inactive fragments. Has no direct bacteriolytic activity..
• Protein Sequence: MTALGLVLLSMMGYSQHMQQANLGDGVATARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVCYSTPDCMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAHAPKYNDKSVGIVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLLGHRQVRDTECPGGRLFAEISSWPHFTHINDTEGVSSTTAPVVPHVHPQAAAPQKPHQSPPAAPKV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
196	N-linked_Glycosylation	WPHFTHINDTEGVSS CCCCCCCCCCCCCCC	42.41	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PGPLB_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PGPLB_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PGPLB_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
USB1_DROME	CG16790	physical	14605208
PGPLE_DROME	PGRP-LE	genetic	22901536

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.